Male Infertility Database

Search Result

Gene id

124222

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

PAQR4 Gene UCSC Ensembl

Gene name

progestin and adipoQ receptor family member 4

Alternate names

progestin and adipoQ receptor family member 4, progestin and adipoQ receptor family member IV,

Gene location

16p13.3 (2969347: 2973483) Exons: 4 NC_000016.10

OMIM

185260

Protein Summary

Protein general information

Q8N4S7

Name: Progestin and adipoQ receptor family member 4 (Progestin and adipoQ receptor family member IV)

Length: 273 Mass: 29126

Tissue specificity: Relatively widely expressed in a range of tissues. {ECO

Sequence

MAFLAGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGLALLGFLVLVPMTMPWGQL
GKDGWLGGTHCVACLAPPAGSVLYHLFMCHQGGSAVYARLLALDMCGVCLVNTLGALPIIHCTLACRPWLRPAAL
VGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLP
ERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD

Structural information

Interpro:	IPR004254
STRING:	ENSP00000321804

Other Databases

GeneCards: PAQR4 Malacards: PAQR4

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0038023	signaling receptor activi ty	IBA	molecular function
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
29961538	Male facto r infertil ity	318 (128 couple s presenting wi th OAT (MF) and 118 maternal a ge-matched cont rol (no MF) sub jects undergoin g infertility t reatment, 72 su rplus cryoprese rved blastocyst s)	Male infertility	RNA-seq	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All