• Gene id: 1241

Gene Summary

• Gene Symbol: LTB4R   Gene   UCSC   Ensembl
• Aliases: BLT1, BLTR, CMKRL1, GPR16, LTB4R1, LTBR1, P2RY7, P2Y7
• Gene name: leukotriene B4 receptor
• Alternate names: leukotriene B4 receptor 1, G protein-coupled receptor 16, LTB4-R 1, LTB4-R1, P2Y purinoceptor 7, chemoattractant receptor-like 1, chemokine receptor-like 1, purinergic receptor P2Y, G-protein coupled, 7,
• Gene location: 14q12 (24311501: 24318035)     Exons: 3     NC_000014.9
• OMIM: 601531

Protein Summary

• Protein general information: Q15722  
  • Name: Leukotriene B4 receptor 1 (LTB4 R 1) (LTB4 R1) (Chemoattractant receptor like 1) (G protein coupled receptor 16) (P2Y purinoceptor 7) (P2Y7)
  • Length: 352  
  • Mass: 37557
  • Tissue specificity: Expressed at highest levels in heart, skeletal muscle and at lower levels in brain and liver. High level of expression in lymphoid tissues.
• Sequence:

  MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFL
  HFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLAT
  PVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVL
  IILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
  VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR003981  IPR003983  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000380008
• Other Databases: GeneCards:  LTB4R  Malacards:  LTB4R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0006954	inflammatory response	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004966	galanin receptor activity	IBA	molecular function
GO:0001632	leukotriene B4 receptor activity	IBA	molecular function
GO:0004974	leukotriene receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0000166	nucleotide binding	TAS	molecular function
GO:0004974	leukotriene receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006936	muscle contraction	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0004974	leukotriene receptor activity	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0061737	leukotriene signaling pathway	IEA	biological process
GO:0061737	leukotriene signaling pathway	IEA	biological process
GO:0061737	leukotriene signaling pathway	IEA	biological process
GO:0061737	leukotriene signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881