• Gene id: 1240

Gene Summary

• Gene Symbol: CMKLR1   Gene   UCSC   Ensembl
• Aliases: CHEMERINR, ChemR23, DEZ, RVER1
• Gene name: chemerin chemokine-like receptor 1
• Alternate names: chemokine-like receptor 1, G-protein coupled receptor ChemR23, G-protein coupled receptor DEZ, chemerin receptor, chemokine receptor-like 1, orphan G-protein coupled receptor, Dez, resolvin E1 receptor,
• Gene location: 12q23.3 (108339346: 108288043)     Exons: 5     NC_000012.12
• OMIM: 610705

Protein Summary

• Protein general information: Q99788  
  • Name: Chemokine like receptor 1 (G protein coupled receptor ChemR23) (G protein coupled receptor DEZ)
  • Length: 373  
  • Mass: 42322
  • Tissue specificity: Prominently expressed in developing osseous and cartilaginous tissue. Also found in adult parathyroid glands. Expressed in cardiovascular system, brain, kidney, gastrointestinal tissues and myeloid tissues. Expressed in a broad array o
• Sequence:

  MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGLVIIIATFKMKKTVNM
  VWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLIHNMFTSVFLLTIISSDRCISVLLPVWSQNH
  RSVRLAYMACMVIWVLAFFLSSPSLVFRDTANLHGKISCFNNFSLSTPGSSSWPTHSQMDPVGYSRHMVVTVTRF
  LCGFLVPVLIITACYLTIVCKLQRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGLPL
  ATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML

• Structural information:
  • Interpro: IPR002258  IPR000826  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000311733
• Other Databases: GeneCards:  CMKLR1  Malacards:  CMKLR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0006935	chemotaxis	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0050848	regulation of calcium-mediated signaling	IBA	biological process
GO:0002430	complement receptor mediated signaling pathway	IBA	biological process
GO:0004875	complement receptor activity	IBA	molecular function
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0010759	positive regulation of macrophage chemotaxis	IBA	biological process
GO:0010759	positive regulation of macrophage chemotaxis	IMP	biological process
GO:0050848	regulation of calcium-mediated signaling	IDA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0006935	chemotaxis	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0032695	negative regulation of interleukin-12 production	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0001501	skeletal system development	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0032695	negative regulation of interleukin-12 production	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0004930	G protein-coupled receptor activity	NAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R