• Gene id: 123920

Gene Summary

• Gene Symbol: CMTM3   Gene   UCSC   Ensembl
• Aliases: BNAS2, CKLFSF3
• Gene name: CKLF like MARVEL transmembrane domain containing 3
• Alternate names: CKLF-like MARVEL transmembrane domain-containing protein 3, chemokine-like factor superfamily member 3,
• Gene location: 16q22.1 (23826728: 23823768)     Exons: 3     NC_000020.11
• Gene summary(Entrez): This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on
• OMIM: 607886

Protein Summary

• Protein general information: Q96MX0  
  • Name: CKLF like MARVEL transmembrane domain containing protein 3 (Chemokine like factor superfamily member 3)
  • Length: 182  
  • Mass: 19714
  • Tissue specificity: Expressed in the leukocytes, placenta and testis. {ECO
• Sequence:

  MWPPDPDPDPDPEPAGGSRPGPAVPGLRALLPARAFLCSLKGRLLLAESGLSFITFICYVASSASAFLTAPLLEF
  LLALYFLFADAMQLNDKWQGLCWPMMDFLRCVTAALIYFAISITAIAKYSDGASKAAGVFGFFATIVFATDFYLI
  FNDVAKFLKQGDSADETTAHKTEEENSDSDSD

• Structural information:
  • Protein Domains: (36..15-)
    (/note="MARVEL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00581"-)
  • Interpro: IPR008253  
  • Prosite: PS51225
  • STRING: ENSP00000400482
• Other Databases: GeneCards:  CMTM3  Malacards:  CMTM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001835	blastocyst hatching	IEA	biological process
GO:0050861	positive regulation of B cell receptor signaling pathway	IEA	biological process
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881