• Gene id: 123904

Gene Summary

• Gene Symbol: NRN1L   Gene   UCSC   Ensembl
• Aliases: MRCC2446, UNQ2446, cpg15-2
• Gene name: neuritin 1 like
• Alternate names: neuritin-like protein,
• Gene location: 16q22.1 (44975290: 45012667)     Exons: 11     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is extracellular and enhances both neurite growth and neuronal survival. The encoded protein is found both as a GPI anchored membrane-bound form and as a secreted form. This activity-related ligand functions as a homodimer

Protein Summary

• Protein general information: Q496H8  
  • Name: Neuritin like protein
  • Length: 165  
  • Mass: 17786
• Sequence:

  MMRCCRRRCCCRQPPHALRPLLLLPLVLLPPLAAAAAGPNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWND
  FHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATAPALPMAPAPPL
  LAAALALAYLLRPLA

• Structural information:
  • Interpro: IPR026144  
  • STRING: ENSP00000342411
• Other Databases: GeneCards:  NRN1L  Malacards:  NRN1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007399	nervous system development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:1990138	neuron projection extension	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881