• Gene id: 123811

Gene Summary

• Gene Symbol: CEP20   Gene   UCSC   Ensembl
• Aliases: C16orf63, FOPNL, FOR20, PHSECRG2
• Gene name: centrosomal protein 20
• Alternate names: lisH domain-containing protein FOPNL, FGFR1OP N-terminal like, FOP-related protein of 20 kDa, lisH domain-containing protein C16orf63, pluripotent embryonic stem cell-related protein,
• Gene location: 16p13.11 (15888602: 15865718)     Exons: 6     NC_000016.10
• OMIM: 617149

Protein Summary

• Protein general information: Q96NB1  
  • Name: LisH domain containing protein FOPNL (FGFR1OP N terminal like protein) (FOP related protein of 20 kDa)
  • Length: 174  
  • Mass: 19778
  • Tissue specificity: Widely expressed. Detected in brain, heart, kidney, liver, lung, skeletal muscle, placenta and intestine. {ECO
• Sequence:

  MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIA
  ESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMD
  DHLRKEEQKSTNIEDLHVSQAVNR

• Structural information:
  • Protein Domains: (49..8-)
    (/note="LisH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00126"-)
  • Interpro: IPR018993  IPR006594  
  • Prosite: PS50896
  • STRING: ENSP00000255759
• Other Databases: GeneCards:  CEP20  Malacards:  CEP20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IBA	cellular component
GO:0036064	ciliary basal body	IBA	cellular component
GO:0060271	cilium assembly	IBA	biological process
GO:0031514	motile cilium	IBA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0060271	cilium assembly	IMP	biological process
GO:0036064	ciliary basal body	ISS	cellular component
GO:0031514	motile cilium	ISS	cellular component
GO:0034453	microtubule anchoring	IEA	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005814	centriole	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881