• Gene id: 1236

Gene Summary

• Gene Symbol: CCR7   Gene   UCSC   Ensembl
• Aliases: BLR2, CC-CKR-7, CCR-7, CD197, CDw197, CMKBR7, EBI1
• Gene name: C-C motif chemokine receptor 7
• Alternate names: C-C chemokine receptor type 7, Bukitt's lymphoma receptor 2, CC chemokine receptor 7, EBV-induced G protein-coupled receptor 1, Epstein-Barr virus induced gene 1, Epstein-Barr virus-induced G-protein coupled receptor 1, MIP-3 beta receptor, chemokine (C-C motif),
• Gene location: 17q21.2 (40565471: 40553768)     Exons: 5     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expres

Protein Summary

• Protein general information: P32248  
  • Name: C C chemokine receptor type 7 (C C CKR 7) (CC CKR 7) (CCR 7) (BLR2) (CDw197) (Epstein Barr virus induced G protein coupled receptor 1) (EBI1) (EBV induced G protein coupled receptor 1) (MIP 3 beta receptor) (CD antigen CD197)
  • Length: 378  
  • Mass: 42874
  • Tissue specificity: Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.
• Sequence:

  MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLG
  NGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCI
  SIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQV
  AQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL
  SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTT
  FSP

• Structural information:
  • Interpro: IPR001718  IPR000355  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 6QZH
  • PDBsum: 6QZH
  • DIP: 5855
  • STRING: ENSP00000246657
• Other Databases: GeneCards:  CCR7  Malacards:  CCR7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0035758	chemokine (C-C motif) ligand 21 binding	IBA	molecular function
GO:0038117	C-C motif chemokine 19 receptor activity	IBA	molecular function
GO:0006935	chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0035757	chemokine (C-C motif) ligand 19 binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016493	C-C chemokine receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0002885	positive regulation of hypersensitivity	IEA	biological process
GO:0002922	positive regulation of humoral immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0016493	C-C chemokine receptor activity	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032735	positive regulation of interleukin-12 production	IEA	biological process
GO:0045060	negative thymic T cell selection	IEA	biological process
GO:0048872	homeostasis of number of cells	IEA	biological process
GO:0072610	interleukin-12 secretion	IEA	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IEA	biological process
GO:0097029	mature conventional dendritic cell differentiation	IEA	biological process
GO:2000510	positive regulation of dendritic cell chemotaxis	IEA	biological process
GO:2000525	positive regulation of T cell costimulation	IEA	biological process
GO:2000526	positive regulation of glycoprotein biosynthetic process involved in immunological synapse formation	IEA	biological process
GO:0002606	positive regulation of dendritic cell antigen processing and presentation	IEA	biological process
GO:0032649	regulation of interferon-gamma production	IEA	biological process
GO:0050706	regulation of interleukin-1 beta secretion	IEA	biological process
GO:0050862	positive regulation of T cell receptor signaling pathway	IEA	biological process
GO:2000522	positive regulation of immunological synapse formation	IEA	biological process
GO:0035758	chemokine (C-C motif) ligand 21 binding	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0016493	C-C chemokine receptor activity	ISS	molecular function
GO:0035757	chemokine (C-C motif) ligand 19 binding	IPI	molecular function
GO:0001768	establishment of T cell polarity	IC	biological process
GO:0001954	positive regulation of cell-matrix adhesion	IC	biological process
GO:0090630	activation of GTPase activity	IC	biological process
GO:0034695	response to prostaglandin E	IC	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IC	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IC	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IC	biological process
GO:0051491	positive regulation of filopodium assembly	IC	biological process
GO:2000147	positive regulation of cell motility	IC	biological process
GO:0002606	positive regulation of dendritic cell antigen processing and presentation	ISS	biological process
GO:0032649	regulation of interferon-gamma production	ISS	biological process
GO:0050706	regulation of interleukin-1 beta secretion	ISS	biological process
GO:2001183	negative regulation of interleukin-12 secretion	ISS	biological process
GO:2000522	positive regulation of immunological synapse formation	ISS	biological process
GO:0002407	dendritic cell chemotaxis	IC	biological process
GO:0002408	myeloid dendritic cell chemotaxis	IC	biological process
GO:0002408	myeloid dendritic cell chemotaxis	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0030838	positive regulation of actin filament polymerization	IC	biological process
GO:0031274	positive regulation of pseudopodium assembly	IC	biological process
GO:0031529	ruffle organization	IC	biological process
GO:0045785	positive regulation of cell adhesion	IC	biological process
GO:0045860	positive regulation of protein kinase activity	IC	biological process
GO:0045860	positive regulation of protein kinase activity	IC	biological process
GO:0046330	positive regulation of JNK cascade	IC	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IC	biological process
GO:0051897	positive regulation of protein kinase B signaling	IC	biological process
GO:0051897	positive regulation of protein kinase B signaling	IC	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IC	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IC	biological process
GO:0071345	cellular response to cytokine stimulus	IDA	biological process
GO:0071731	response to nitric oxide	IC	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IDA	biological process
GO:2000669	negative regulation of dendritic cell apoptotic process	IC	biological process
GO:0002885	positive regulation of hypersensitivity	ISS	biological process
GO:0002922	positive regulation of humoral immune response	ISS	biological process
GO:0006954	inflammatory response	NAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0032735	positive regulation of interleukin-12 production	ISS	biological process
GO:0097022	lymphocyte migration into lymph node	TAS	biological process
GO:0097029	mature conventional dendritic cell differentiation	ISS	biological process
GO:2000510	positive regulation of dendritic cell chemotaxis	ISS	biological process
GO:2000525	positive regulation of T cell costimulation	ISS	biological process
GO:2000526	positive regulation of glycoprotein biosynthetic process involved in immunological synapse formation	ISS	biological process
GO:2000547	regulation of dendritic cell dendrite assembly	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0038116	chemokine (C-C motif) ligand 21 signaling pathway	IEA	biological process
GO:0038115	chemokine (C-C motif) ligand 19 signaling pathway	IEA	biological process
GO:0038115	chemokine (C-C motif) ligand 19 signaling pathway	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0038117	C-C motif chemokine 19 receptor activity	IDA	molecular function
GO:0038121	C-C motif chemokine 21 receptor activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
pulmonary sarcoidosis	PMID:12626344
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881