• Gene id: 123591

Gene Summary

• Gene Symbol: TMEM266   Gene   UCSC   Ensembl
• Aliases: C15orf27, HVRP1, HsHVRP1, hTMEM266
• Gene name: transmembrane protein 266
• Alternate names: transmembrane protein 266, Hv1 related protein 1, transmembrane protein C15orf27,
• Gene location: 15q24.2 (76059912: 76204962)     Exons: 13     NC_000015.10
• OMIM: 602351

Protein Summary

• Protein general information: Q2M3C6  
  • Name: Transmembrane protein 266 (hTMEM266) (HV1 related protein 1) (HsHVRP1)
  • Length: 531  
  • Mass: 58444
  • Tissue specificity: Mainly expressed in the cerebellum (PubMed
• Sequence:

  MAVAPSFNMTNPQPAIEGGISEVEIISQQVDEETKSIAPVQLVNFAYRDLPLAAVDLSTAGSQLLSNLDEDYQRE
  GSNWLKPCCGKRAAVWQVFLLSASLNSFLVACVILVVILLTLELLIDIKLLQFSSAFQFAGVIHWISLVILSVFF
  SETVLRIVVLGIWDYIENKIEVFDGAVIILSLAPMVASTVANGPRSPWDAISLIIMLRIWRVKRVIDAYVLPVKL
  EMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRFKVLEAG
  TWDEETAAESVVEELQPSQEATMKDDMNSYISQYYNGPSSDSGVPEPAVCMVTTAAIDIHQPNISSDLFSLDMPL
  KLGGNGTSATSESASRSSVTRAQSDSSQTLGSSMDCSTAREEPSSEPGPSPPPLPSQQQVEEATVQDLLSSLSED
  PCPSQKALDPAPLARPSPAGSAQTSPELEHRVSLFNQKNQEGFTVFQIRPVIHFQPTVPMLEDKFRSLESKEQKL
  HRVPEA

• Structural information:
  • Interpro: IPR042857  IPR027359  
  • STRING: ENSP00000373594
• Other Databases: GeneCards:  TMEM266  Malacards:  TMEM266

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0022832	voltage-gated channel activity	IDA	NOT|molecular function
GO:0015267	channel activity	IDA	NOT|molecular function
GO:0030425	dendrite	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray