• Gene id: 1235

Gene Summary

• Gene Symbol: CCR6   Gene   UCSC   Ensembl
• Aliases: BN-1, C-C CKR-6, CC-CKR-6, CCR-6, CD196, CKR-L3, CKRL3, CMKBR6, DCR2, DRY6, GPR29, GPRCY4, STRL22
• Gene name: C-C motif chemokine receptor 6
• Alternate names: C-C chemokine receptor type 6, G protein-coupled receptor 29, LARC receptor, chemokine (C-C motif) receptor 6, chemokine (C-C) receptor 6, chemokine receptor-like 3, seven-transmembrane receptor, lymphocyte, 22,
• Gene location: 6q27 (167111806: 167139140)     Exons: 4     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The gene is preferentially expressed by immature dendritic cells and memory T cells. The ligan
• OMIM: 601835

Protein Summary

• Protein general information: P51684  
  • Name: C C chemokine receptor type 6 (C C CKR 6) (CC CKR 6) (CCR 6) (Chemokine receptor like 3) (CKR L3) (DRY6) (G protein coupled receptor 29) (GPR CY4) (GPRCY4) (LARC receptor) (CD antigen CD196)
  • Length: 374  
  • Mass: 42494
  • Tissue specificity: Sperm. Mainly localized in the tail and in the postacrosomal region but is also found in the midpiece and basal region in a small percentage of sperm cells. Reduced levels found in the sperms of asthenozoospermia and leukocytospermia p
• Sequence:

  MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVITFAFYK
  KARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISMDRYIAIVQA
  TKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFI
  PLMFMIFCYTFIVKTLVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAANLGKMNRSCQSEKLIGYTKTV
  TEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQTSETADNDNASSFTM

• Structural information:
  • Interpro: IPR004067  IPR000355  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • DIP: 5865
  • STRING: ENSP00000383715
• Other Databases: GeneCards:  CCR6  Malacards:  CCR6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0006935	chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0072679	thymocyte migration	IBA	biological process
GO:2000510	positive regulation of dendritic cell chemotaxis	IBA	biological process
GO:0019957	C-C chemokine binding	IDA	molecular function
GO:0060474	positive regulation of flagellated sperm motility involved in capacitation	IDA	biological process
GO:0097225	sperm midpiece	IDA	cellular component
GO:0097228	sperm principal piece	IDA	cellular component
GO:0097524	sperm plasma membrane	IDA	cellular component
GO:0006935	chemotaxis	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0060326	cell chemotaxis	IDA	biological process
GO:0036126	sperm flagellum	IDA	cellular component
GO:0016493	C-C chemokine receptor activity	IDA	molecular function
GO:0019957	C-C chemokine binding	IMP	molecular function
GO:1904155	DN2 thymocyte differentiation	ISS	biological process
GO:0072678	T cell migration	ISS	biological process
GO:0002523	leukocyte migration involved in inflammatory response	ISS	biological process
GO:0019722	calcium-mediated signaling	IMP	biological process
GO:0006935	chemotaxis	IMP	biological process
GO:0016493	C-C chemokine receptor activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000404	regulation of T cell migration	ISS	biological process
GO:1904156	DN3 thymocyte differentiation	ISS	biological process
GO:0072679	thymocyte migration	ISS	biological process
GO:0072676	lymphocyte migration	ISS	biological process
GO:0048290	isotype switching to IgA isotypes	ISS	biological process
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016493	C-C chemokine receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0006959	humoral immune response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0010634	positive regulation of epithelial cell migration	IEA	biological process
GO:1904155	DN2 thymocyte differentiation	IEA	biological process
GO:0097524	sperm plasma membrane	IEA	cellular component
GO:0097228	sperm principal piece	IEA	cellular component
GO:0072678	T cell migration	IEA	biological process
GO:0060474	positive regulation of flagellated sperm motility involved in capacitation	IEA	biological process
GO:0019957	C-C chemokine binding	IEA	molecular function
GO:0002523	leukocyte migration involved in inflammatory response	IEA	biological process
GO:2000510	positive regulation of dendritic cell chemotaxis	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:2000404	regulation of T cell migration	IEA	biological process
GO:1904156	DN3 thymocyte differentiation	IEA	biological process
GO:0072679	thymocyte migration	IEA	biological process
GO:0072676	lymphocyte migration	IEA	biological process
GO:0048290	isotype switching to IgA isotypes	IEA	biological process
GO:0036126	sperm flagellum	IEA	cellular component
GO:0016493	C-C chemokine receptor activity	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Systemic sclerosis	KEGG:H01492
Systemic sclerosis	KEGG:H01492
Exanthem	PMID:18384452
Cutaneous T cell lymphoma	PMID:22048239
Breast cancer	PMID:21624121
systemic scleroderma	PMID:21742595
Psoriasis	PMID:10843722
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray