• Gene id: 1234

Gene Summary

• Gene Symbol: CCR5   Gene   UCSC   Ensembl
• Aliases: CC-CKR-5, CCCKR5, CCR-5, CD195, CKR-5, CKR5, CMKBR5, IDDM22
• Gene name: C-C motif chemokine receptor 5 (gene/pseudogene)
• Alternate names: C-C chemokine receptor type 5, C-C motif chemokine receptor 5 A159A, HIV-1 fusion coreceptor, chemokine (C-C motif) receptor 5, chemokine receptor CCR5, chemokine recptor CCR5 Delta32, chemr13,
• Gene location: 3p21.31 (46370141: 46376205)     Exons: 3     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-recep
• OMIM: 601373

Protein Summary

• Protein general information: P51681  
  • Name: C C chemokine receptor type 5 (C C CKR 5) (CC CKR 5) (CCR 5) (CCR5) (CHEMR13) (HIV 1 fusion coreceptor) (CD antigen CD195)
  • Length: 352  
  • Mass: 40,524
• Sequence:

  MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAIS
  DLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSV
  ITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCR
  NEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
  GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

• Structural information:
  • Interpro: IPR002240  IPR000355  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 1ND8 1NE0 1OPN 1OPT 1OPW 2L87 2MZX 2RLL 2RRS 4MBS 5UIW
  • PDBsum: 1ND8 1NE0 1OPN 1OPT 1OPW 2L87 2MZX 2RLL 2RRS 4MBS 5UIW
  • DIP: 5866
  • STRING: ENSP00000292303
• Other Databases: GeneCards:  CCR5  Malacards:  CCR5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	IEP	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0003779	actin binding	IDA	molecular function
GO:0004435	phosphatidylinositol phospholipase C activity	TAS	molecular function
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006816	calcium ion transport	IDA	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IMP	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007267	cell-cell signaling	IDA	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0014808	release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	biological process
GO:0015026	coreceptor activity	TAS	molecular function
GO:0016493	C-C chemokine receptor activity	IDA	molecular function
GO:0016493	C-C chemokine receptor activity	NAS	molecular function
GO:0019064	fusion of virus membrane with host plasma membrane	TAS	biological process
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0023052	signaling	IEP	biological process
GO:0030260	entry into host cell	TAS	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070723	response to cholesterol	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IEP	biological process
GO:0071791	chemokine (C-C motif) ligand 5 binding	IPI	molecular function
GO:0000165	MAPK cascade	IEP	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0003779	actin binding	IDA	molecular function
GO:0004435	phosphatidylinositol phospholipase C activity	TAS	molecular function
GO:0004871	signal transducer activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006816	calcium ion transport	IDA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	IEA	biological process
GO:0006955	immune response	TAS	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IMP	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007267	cell-cell signaling	IDA	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0014808	release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	biological process
GO:0015026	coreceptor activity	TAS	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016493	C-C chemokine receptor activity	IEA	molecular function
GO:0016493	C-C chemokine receptor activity	IDA	molecular function
GO:0016493	C-C chemokine receptor activity	NAS	molecular function
GO:0019064	fusion of virus membrane with host plasma membrane	TAS	biological process
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0023052	signaling	IEP	biological process
GO:0030260	entry into host cell	TAS	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070723	response to cholesterol	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IEP	biological process
GO:0071791	chemokine (C-C motif) ligand 5 binding	IPI	molecular function
GO:0000165	MAPK cascade	IEP	biological process
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0003779	actin binding	IDA	molecular function
GO:0004435	phosphatidylinositol phospholipase C activity	TAS	molecular function
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006816	calcium ion transport	IDA	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IMP	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007267	cell-cell signaling	IDA	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0014808	release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	biological process
GO:0015026	coreceptor activity	TAS	molecular function
GO:0016493	C-C chemokine receptor activity	IDA	molecular function
GO:0016493	C-C chemokine receptor activity	NAS	molecular function
GO:0019064	fusion of virus membrane with host plasma membrane	TAS	biological process
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0023052	signaling	IEP	biological process
GO:0030260	entry into host cell	TAS	biological process
GO:0070723	response to cholesterol	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IEP	biological process
GO:0071791	chemokine (C-C motif) ligand 5 binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04144	Endocytosis
hsa04062	Chemokine signaling pathway
hsa05203	Viral carcinogenesis
hsa05170	Human immunodeficiency virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05145	Toxoplasmosis

Diseases

Associated diseases	References
Cancer	GAD: 18205260
Cancer (bladder)	GAD: 18405329
Cancer (cervical)	GAD: 17094383
Cancer (head and neck)	GAD: 18386165
Cancer (Hepatocellular)	GAD: 18205260
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 20038229
Cancer (melanoma)	GAD: 17909797
Cancer (pancreatic)	GAD: 16614115
Cancer (prostate)	GAD: 19064579
Cancer (breast)	GAD: 19212663
Aneurysm	GAD: 19476483
Aortic stenosis	GAD: 15039132
Apoplexy	GAD: 19874552
Atherosclerosis	GAD: 15302103
Blood pressure	GAD: 17060059
Brain ischemia	GAD: 19028820
Cardiovascular disease	GAD: 11975906
Carotid artery diseases	GAD: 19506371
Hypertension	GAD: 12680626
Restenosis	GAD: 12082592
Diabetic nephropathy	GAD: 17428349
Uveitis	GAD: 17417600
AHG deficiency disease	GAD: 12612937
Anemia	GAD: 12532229
Sickle cell anemia	GAD: 16305685
Hemophilia	GAD: 19172482
Sarcoidosis	GAD: 15976369
Mucocutaneous lymph node syndrome	GAD: 20628649
Addison's disease	GAD: 15086346
Arthritis	GAD: 12846056
Asthma	GAD: 11081537
Sjogren's syndrome	GAD: 12412204
Inflammatory bowel disease	GAD: 11354628
Rheumatoid arthritis	GAD: 10323455
Multiple sclerosis	GAD: 16182378
Periodontitis	GAD: 14697747
Systemic lupus erythematosus (SLE)	GAD: 12913933
Systemic lupus erythematosus (SLE)	GAD: 12913933
Allergic rhinitis	KEGG: H01360
Behcet's disease	GAD: 15009175
Celiac disease	GAD: 20190752
Chronic ulcerative colitis	GAD: 11393656
Crohn's disease	GAD: 11377705
Biliary atresia	GAD: 18194353
Diabetes	GAD: 15135805
Polymyalgia rheumatica	GAD: 11781692
Myasthenia gravis	GAD: 14533004
Alzheimer's disease	GAD: 15288441
Schizophrenia	GAD: 16513874
Chronic renal failure	GAD: 15610230
Kidney diseases	GAD: 19196047
Pregnancy loss	GAD: 19116725
Female infertility	INFBASE: 14981141
Male factor infertility	MIK: 16873132
Endometriosis	GAD: 14981141
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Wegener granulomatosis	GAD: 12858455
Erythema	GAD: 19225544
Nephropathy	GAD: 12610055
Male infertility	MIK: 16873132

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16873132	Male infertility				Male infertility	CCR5 P450arom