• Gene id: 123355

Gene Summary

• Gene Symbol: LRRC28   Gene   UCSC   Ensembl
• Gene name: leucine rich repeat containing 28
• Alternate names: leucine-rich repeat-containing protein 28,
• Gene location: 15q26.3 (99251448: 99390728)     Exons: 15     NC_000015.10

Protein Summary

• Protein general information: Q86X40  
  • Name: Leucine rich repeat containing protein 28
  • Length: 367  
  • Mass: 41912
• Sequence:

  MASELCKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQYLERLYMKRNSLTSLPENLAQKLPNLVELYLHSN
  NIVVVPEAIGSLVKLQCLDLSDNALEIVCPEIGRLRALRHLRLANNQLQFLPPEVGDLKELQTLDISTNRLLTLP
  ERLHMCLSLQYLTVDRNRLWYVPRHLCQLPSLNELSMAGNRLAFLPLDLGRSRELQYVYVDNNIHLKGLPSYLYN
  KVIGCSGCGAPIQVSEVKLLSFSSGQRTVFLPAEVKAIGTEHDHVLPLQELAMRGLYHTYHSLLKDLNFLSPISL
  PRSLLELLHCPLGHCHRCSEPMFTIVYPKLFPLRETPMAGLHQWKTTVSFVAYCCSTQCLQTFDLLS

• Structural information:
  • Interpro: IPR001611  IPR003591  IPR032675  
  • STRING: ENSP00000304923
• Other Databases: GeneCards:  LRRC28  Malacards:  LRRC28

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071470	cellular response to osmotic stress	IBA	biological process
GO:0034702	ion channel complex	IBA	cellular component
GO:0015734	taurine transport	IBA	biological process
GO:0005225	volume-sensitive anion channel activity	IBA	molecular function
GO:0015810	aspartate transmembrane transport	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0015698	inorganic anion transport	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray