• Gene id: 1233

Gene Summary

• Gene Symbol: CCR4   Gene   UCSC   Ensembl
• Aliases: CC-CKR-4, CD194, CKR4, CMKBR4, ChemR13, HGCN:14099, K5-5
• Gene name: C-C motif chemokine receptor 4
• Alternate names: C-C chemokine receptor type 4, C-C CKR-4, CCR-4, chemokine (C-C motif) receptor 4, chemokine (C-C) receptor 4,
• Gene location: 3p22.3 (32951554: 32956348)     Exons: 2     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the G-protein-coupled receptor family . It is a receptor for the CC chemokine - MIP-1, RANTES, TARC and MCP-1. Chemokines are a group of small polypeptide, structurally related molecules that regulate cell traff
• OMIM: 618133

Protein Summary

• Protein general information: P51679  
  • Name: C C chemokine receptor type 4 (C C CKR 4) (CC CKR 4) (CCR 4) (CCR4) (K5 5) (CD antigen CD194)
  • Length: 360  
  • Mass: 41403
  • Tissue specificity: Predominantly expressed in the thymus, in peripheral blood leukocytes, including T-cells, mostly CD4+ cells, and basophils, and in platelets; at lower levels, in the spleen and in monocytes. Detected also in macrophages, IL-2-activated
• Sequence:

  MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTD
  VYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRART
  LTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMI
  IRTLQHCKNEKKNKAVKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLN
  PIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL

• Structural information:
  • Interpro: IPR002239  IPR000355  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • DIP: 5848
  • STRING: ENSP00000332659
• Other Databases: GeneCards:  CCR4  Malacards:  CCR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006935	chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016493	C-C chemokine receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050927	positive regulation of positive chemotaxis	IEA	biological process
GO:0046677	response to antibiotic	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0009314	response to radiation	IEA	biological process
GO:0048872	homeostasis of number of cells	IEA	biological process
GO:0016493	C-C chemokine receptor activity	IEA	molecular function
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0002507	tolerance induction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa05203	Viral carcinogenesis
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
pancreatic cancer	PMID:12761880
Rheumatoid arthritis	PMID:19942450
Rheumatoid arthritis	PMID:25430645
Osteoarthritis	PMID:19942450
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R