• Gene id: 123264

Gene Summary

• Gene Symbol: SLC51B   Gene   UCSC   Ensembl
• Aliases: OSTB, OSTBETA
• Gene name: solute carrier family 51 subunit beta
• Alternate names: organic solute transporter subunit beta, OST-beta, organic solute transporter beta subunit, solute carrier family 51 beta subunit,
• Gene location: 15q22.31 (65045386: 65053396)     Exons: 5     NC_000015.10
• OMIM: 612137

Protein Summary

• Protein general information: Q86UW2  
  • Name: Organic solute transporter subunit beta (OST beta) (Solute carrier family 51 subunit beta)
  • Length: 128  
  • Mass: 14346
  • Tissue specificity: Widely expressed with a high expression in ileum. Expressed in testis, colon, liver, small intestine, kidney, ovary and adrenal gland; and at low levels in heart, lung, brain, pituitary, thyroid gland, uterus, prostate, mammary gland a
• Sequence:

  MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETP
  EVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES

• Structural information:
  • Interpro: IPR029387  
  • STRING: ENSP00000335292
• Other Databases: GeneCards:  SLC51B  Malacards:  SLC51B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032991	protein-containing complex	IBA	cellular component
GO:0015721	bile acid and bile salt transport	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0060050	positive regulation of protein glycosylation	ISS	biological process
GO:0032991	protein-containing complex	ISS	cellular component
GO:0015721	bile acid and bile salt transport	ISS	biological process
GO:0090314	positive regulation of protein targeting to membrane	ISS	biological process
GO:0070863	positive regulation of protein exit from endoplasmic reticulum	ISS	biological process
GO:0046982	protein heterodimerization activity	ISS	molecular function
GO:0031647	regulation of protein stability	ISS	biological process
GO:0016021	integral component of membrane	ISS	cellular component
GO:0015721	bile acid and bile salt transport	IEA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090314	positive regulation of protein targeting to membrane	IEA	biological process
GO:0071702	organic substance transport	IEA	biological process
GO:0070863	positive regulation of protein exit from endoplasmic reticulum	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0031647	regulation of protein stability	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0060050	positive regulation of protein glycosylation	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0015721	bile acid and bile salt transport	IEA	biological process
GO:0015125	bile acid transmembrane transporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0032782	bile acid secretion	IPI	biological process

KEGG pathways

Pathway id	Pathway name
hsa04976	Bile secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray