• Gene id: 123228

Gene Summary

• Gene Symbol: SENP8   Gene   UCSC   Ensembl
• Aliases: DEN1, NEDP1, PRSC2
• Gene name: SUMO peptidase family member, NEDD8 specific
• Alternate names: sentrin-specific protease 8, NEDD8 specific-protease cysteine 2, NEDD8-specific protease 1, SUMO sentrin specific protease family member 8, SUMO/sentrin peptidase family member, NEDD8 specific, SUMO/sentrin specific peptidase family member 8, deneddylase 1, prot,
• Gene location: 15q23 (72114257: 72143691)     Exons: 5     NC_000015.10
• Gene summary(Entrez): This gene encodes a cysteine protease that is a member of the sentrin-specific protease family. The encoded protein is involved in processing and deconjugation of the ubiquitin-like protein termed, neural precursor cell expressed developmentally downregul
• OMIM: 608659

Protein Summary

• Protein general information: Q96LD8  
  • Name: Sentrin specific protease 8 (EC 3.4.22. ) (Deneddylase 1) (NEDD8 specific protease 1) (Protease, cysteine 2) (Sentrin/SUMO specific protease SENP8)
  • Length: 212  
  • Mass: 24107
  • Tissue specificity: Broadly expressed, with highest levels in kidney and pancreas. {ECO
• Sequence:

  MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFL
  EPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFV
  EEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK

• Structural information:
  • Interpro: IPR038765  IPR003653  
  • Prosite: PS50600
  • PDB: 1XT9 2BKQ 2BKR
  • PDBsum: 1XT9 2BKQ 2BKR
  • STRING: ENSP00000340505
• Other Databases: GeneCards:  SENP8  Malacards:  SENP8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0019784	NEDD8-specific protease activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)