• Gene id: 1232

Gene Summary

• Gene Symbol: CCR3   Gene   UCSC   Ensembl
• Aliases: C C CKR3, CC-CKR-3, CD193, CKR 3, CKR3, CMKBR3
• Gene name: C-C motif chemokine receptor 3
• Alternate names: C-C chemokine receptor type 3, C-C CKR-3, CC chemokine receptor 3, CCR-3, b-chemokine receptor, chemokine (C-C motif) receptor 3, eosinophil CC chemokine receptor 3, eosinophil eotaxin receptor,
• Gene location: 3p21.31 (46210698: 46266705)     Exons: 6     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP
• OMIM: 608145

Protein Summary

• Protein general information: P51677  
  • Name: C C chemokine receptor type 3 (C C CKR3) (C C CKR 3) (CC CKR 3) (CCR 3) (CCR3) (CKR 3) (CKR3) (Eosinophil eotaxin receptor) (CD antigen CD193)
  • Length: 355  
  • Mass: 41044
  • Tissue specificity: In eosinophils as well as trace amounts in neutrophils and monocytes. {ECO
• Sequence:

  MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILIKYRRLRIMTNIYLLN
  LAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFG
  VITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKT
  LLRCPSKKKYKAIRLIFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
  YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF

• Structural information:
  • Interpro: IPR002238  IPR000355  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • DIP: 5846
  • STRING: ENSP00000441600
• Other Databases: GeneCards:  CCR3  Malacards:  CCR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006935	chemotaxis	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016493	C-C chemokine receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019957	C-C chemokine binding	IEA	molecular function
GO:0001938	positive regulation of endothelial cell proliferation	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0016493	C-C chemokine receptor activity	IEA	molecular function
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0019957	C-C chemokine binding	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa05203	Viral carcinogenesis
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Allergic rhinitis	KEGG:H01360
Allergic rhinitis	KEGG:H01360
Cutaneous lupus erythematosus	PMID:21844117
granulomatosis with polyangiitis	PMID:11529927
granulomatosis with polyangiitis	PMID:12716450
Cystic fibrosis	PMID:19017998
Urticaria	PMID:15721839
ovary epithelial cancer	PMID:20103664
Multiple sclerosis	PMID:21427490
Asthma	PMID:19017998
Asthma	PMID:20220260
Chronic obstructive pulmonary disease	PMID:19017998
Atopic dermatitis	PMID:16449815
periapical granuloma	PMID:11683586
Rheumatoid arthritis	PMID:19017998
Systemic lupus erythematosus	PMID:21180278
obesity	PMID:18492752
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq