• Gene id: 1230

Gene Summary

• Gene Symbol: CCR1   Gene   UCSC   Ensembl
• Aliases: CD191, CKR-1, CKR1, CMKBR1, HM145, MIP1aR, SCYAR1
• Gene name: C-C motif chemokine receptor 1
• Alternate names: C-C chemokine receptor type 1, C-C CKR-1, CC-CKR-1, CCR-1, LD78 receptor, MIP-1alpha-R, RANTES receptor, RANTES-R, chemokine (C-C motif) receptor 1, macrophage inflammatory protein 1-alpha receptor,
• Gene location: 3p21.31 (46208312: 46201710)     Exons: 2     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), re
• OMIM: 601159

Protein Summary

• Protein general information: P32246  
  • Name: C C chemokine receptor type 1 (C C CKR 1) (CC CKR 1) (CCR 1) (CCR1) (HM145) (LD78 receptor) (Macrophage inflammatory protein 1 alpha receptor) (MIP 1alpha R) (RANTES R) (CD antigen CD191)
  • Length: 355  
  • Mass: 41173
  • Tissue specificity: Widely expressed in different hematopoietic cells.
• Sequence:

  METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLN
  LAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFG
  VITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKI
  LLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
  YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF

• Structural information:
  • Interpro: IPR002236  IPR034321  IPR000355  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 1Y5D
  • PDBsum: 1Y5D
  • DIP: 5832
  • STRING: ENSP00000296140
• Other Databases: GeneCards:  CCR1  Malacards:  CCR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0071791	chemokine (C-C motif) ligand 5 binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0035717	chemokine (C-C motif) ligand 7 binding	IBA	molecular function
GO:0019956	chemokine binding	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006935	chemotaxis	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016493	C-C chemokine receptor activity	IEA	molecular function
GO:0090026	positive regulation of monocyte chemotaxis	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0009611	response to wounding	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0051928	positive regulation of calcium ion transport	IDA	biological process
GO:0007267	cell-cell signaling	IDA	biological process
GO:0004950	chemokine receptor activity	IDA	molecular function
GO:0006955	immune response	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IDA	biological process
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0006816	calcium ion transport	IDA	biological process
GO:0004435	phosphatidylinositol phospholipase C activity	IDA	molecular function
GO:0016493	C-C chemokine receptor activity	IDA	molecular function
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0006887	exocytosis	IDA	biological process
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0071791	chemokine (C-C motif) ligand 5 binding	IPI	molecular function
GO:0071791	chemokine (C-C motif) ligand 5 binding	IPI	molecular function
GO:0071791	chemokine (C-C motif) ligand 5 binding	IPI	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0005886	plasma membrane	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045672	positive regulation of osteoclast differentiation	IMP	biological process
GO:0030502	negative regulation of bone mineralization	IMP	biological process
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0019221	cytokine-mediated signaling pathway	NAS	biological process
GO:0071791	chemokine (C-C motif) ligand 5 binding	IPI	molecular function
GO:0035717	chemokine (C-C motif) ligand 7 binding	IPI	molecular function
GO:0035717	chemokine (C-C motif) ligand 7 binding	IPI	molecular function
GO:0006935	chemotaxis	NAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Allergic rhinitis	KEGG:H01360
Allergic rhinitis	KEGG:H01360
Alzheimer's disease	PMID:14595653
Lewy body dementia	PMID:14595653
Allergic contact dermatitis	PMID:18844696
Coronary artery disease	PMID:12742282
Rheumatoid arthritis	PMID:12860725
Cerebral amyloid angiopathy	PMID:14595653
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R