• Gene id: 122970

Gene Summary

• Gene Symbol: ACOT4   Gene   UCSC   Ensembl
• Aliases: PTE-Ib, PTE1B, PTE2B
• Gene name: acyl-CoA thioesterase 4
• Alternate names: peroxisomal succinyl-coenzyme A thioesterase, PTE-2b, acyl-coenzyme A thioesterase 4, peroxisomal acyl coenzyme A thioester hydrolase Ib, peroxisomal acyl-CoA thioesterase 2B, peroxisomal long-chain acyl-CoA thioesterase Ib,
• Gene location: 14q24.3 (73591705: 73595765)     Exons: 3     NC_000014.9
• OMIM: 611601

Protein Summary

• Protein general information: Q8N9L9  
  • Name: Peroxisomal succinyl coenzyme A thioesterase (EC 3.1.2.3) (Acyl coenzyme A thioesterase 4) (Acyl CoA thioesterase 4) (EC 3.1.2.2) (PTE 2b) (Peroxisomal acyl coenzyme A thioester hydrolase Ib) (Peroxisomal long chain acyl CoA thioesterase Ib) (PTE Ib)
  • Length: 421  
  • Mass: 46327
  • Tissue specificity: Strongest expression in liver and kidney and weaker expression in placenta, heart, and muscle. {ECO
• Sequence:

  MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADARGELDLERAPALGGSFAGL
  EPMGLLWALEPEKPFWRFLKRDVQIPFVVELEVLDGHDPEPGRLLCQAQHERHFLPPGVRRQSVRAGRVRATLFL
  PPGPGPFPGIIDIFGIGGGLLEYRASLLAGHGFATLALAYYNFEDLPNNMDNISLEYFEEAVCYMLQHPQVKGPG
  IGLLGISLGADICLSMASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLRRIKVAFSGLVDIVDIRNALV
  GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKPQIICYPGTGHYIEPPYFPLCPASLH
  RLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKTAVPKL

• Structural information:
  • Interpro: IPR029058  IPR016662  IPR014940  IPR006862  IPR042490  
  • PDB: 3K2I
  • PDBsum: 3K2I
  • STRING: ENSP00000323071
• Other Databases: GeneCards:  ACOT4  Malacards:  ACOT4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006104	succinyl-CoA metabolic process	IDA	biological process
GO:0006637	acyl-CoA metabolic process	IDA	biological process
GO:0043648	dicarboxylic acid metabolic process	IDA	biological process
GO:0047617	acyl-CoA hydrolase activity	IDA	molecular function
GO:0000038	very long-chain fatty acid metabolic process	IDA	biological process
GO:0046459	short-chain fatty acid metabolic process	IDA	biological process
GO:0001676	long-chain fatty acid metabolic process	IDA	biological process
GO:0032789	unsaturated monocarboxylic acid metabolic process	IDA	biological process
GO:0019605	butyrate metabolic process	IDA	NOT|biological process
GO:0005777	peroxisome	IDA	cellular component
GO:0032788	saturated monocarboxylic acid metabolic process	IDA	biological process
GO:0047617	acyl-CoA hydrolase activity	IBA	molecular function
GO:0006637	acyl-CoA metabolic process	IBA	biological process
GO:0006631	fatty acid metabolic process	IBA	biological process
GO:0005777	peroxisome	IBA	cellular component
GO:0006637	acyl-CoA metabolic process	IEA	biological process
GO:0016790	thiolester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0102991	myristoyl-CoA hydrolase activity	IEA	molecular function
GO:0004778	succinyl-CoA hydrolase activity	IEA	molecular function
GO:0016290	palmitoyl-CoA hydrolase activity	IEA	molecular function
GO:0044466	glutaryl-CoA hydrolase activity	IEA	molecular function
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0006637	acyl-CoA metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0006104	succinyl-CoA metabolic process	IEA	biological process
GO:0043648	dicarboxylic acid metabolic process	IEA	biological process
GO:0046459	short-chain fatty acid metabolic process	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0006637	acyl-CoA metabolic process	IEA	biological process
GO:0047617	acyl-CoA hydrolase activity	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0047617	acyl-CoA hydrolase activity	IDA	molecular function
GO:0043649	dicarboxylic acid catabolic process	IDA	biological process
GO:0005777	peroxisome	IDA	cellular component
GO:0004778	succinyl-CoA hydrolase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01040	Biosynthesis of unsaturated fatty acids
hsa00062	Fatty acid elongation
hsa04913	Ovarian steroidogenesis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq