• Gene id: 122809

Gene Summary

• Gene Symbol: SOCS4   Gene   UCSC   Ensembl
• Aliases: SOCS7
• Gene name: suppressor of cytokine signaling 4
• Alternate names: suppressor of cytokine signaling 4, SH2 domain containing SOCS box protein, SOCS-4, SOCS-7, suppressor of cytokine signaling 7,
• Gene location: 14q22.3 (51197680: 51174549)     Exons: 2     NC_000018.10
• Gene summary(Entrez): The protein encoded by this gene contains a SH2 domain and a SOCS BOX domain. The protein thus belongs to the suppressor of cytokine signaling (SOCS), also known as STAT-induced STAT inhibitor (SSI), protein family. SOCS family members are known to be cyt
• OMIM: 616337

Protein Summary

• Protein general information: Q8WXH5  
  • Name: Suppressor of cytokine signaling 4 (SOCS 4) (Suppressor of cytokine signaling 7) (SOCS 7)
  • Length: 440  
  • Mass: 50623
• Sequence:

  MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIE
  LDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKRKIHISELMLDKCPFPPRSDLAFRWHFIKRH
  TAPINSKSDEWVSTDLSQTELRDGQLKRRNMEENINCFSHTNVQPCVITTDNALCREGPMTGSVMNLVSNNSIED
  SDMDSDDEILTLCTSSRKRNKPKWDLDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
  EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEP
  LLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLKEYHYKSKVRVLRIDAPEQQC

• Structural information:
  • Protein Domains: (286..38-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (376..42-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR000980  IPR036860  IPR028416  IPR022252  IPR035864   IPR037342  IPR001496  IPR036036  
  • Prosite: PS50001 PS50225
  • CDD: cd10385 cd03738
  • PDB: 2IZV
  • PDBsum: 2IZV
  • DIP: 29568
  • STRING: ENSP00000378855
• Other Databases: GeneCards:  SOCS4  Malacards:  SOCS4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IBA	molecular function
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0007175	negative regulation of epidermal growth factor-activated receptor activity	IDA	biological process
GO:0007175	negative regulation of epidermal growth factor-activated receptor activity	IEA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04630	JAK-STAT signaling pathway
hsa04910	Insulin signaling pathway
hsa04917	Prolactin signaling pathway
hsa04930	Type II diabetes mellitus

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)