About Us

Search Result


Gene id 122786
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol FRMD6   Gene   UCSC   Ensembl
Aliases C14orf31, EX1, Willin, c14_5320
Gene name FERM domain containing 6
Alternate names FERM domain-containing protein 6, 4.1 ezrin radixin moesin (FERM)-containing protein, expanded homolog,
Gene location 14q22.1 (3803765: 3714627)     Exons: 32     NC_000017.11
OMIM 614555

Protein Summary

Protein general information Q96NE9  

Name: FERM domain containing protein 6 (Willin)

Length: 622  Mass: 72044

Sequence MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLSVIQNNEHVYMELSQK
LYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENGRLISDRAARYYYYWHLRKQVLHSQCVLREE
AYFLLAAFALQADLGNFKRNKHYGKYFEPEAYFPSWVVSKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAVR
LDDVAVHYYRLYKDKREIEASLTLGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKL
IYYTGCPMRSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDNLDLDMDQLEKRSRASGSSAGS
MKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRKLKTCSSMTSHGSSHTSGVESGGKDRLEEDL
QDDEIEMLVDDPRDLEQMNEESLEVSPDMCIYITEDMLMSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDS
LPQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFP
VKRTSKYFSLDLTHDEVPEFVV
Structural information
Protein Domains
(16..32-)
(/note="FERM-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00084"-)
Interpro:  IPR019749  IPR014352  IPR035963  IPR019748  IPR000299  
IPR018979  IPR018980  IPR040179  IPR041781  IPR011993  IPR029071  
Prosite:   PS50057
CDD:   cd14473 cd13185
MINT:  
STRING:   ENSP00000343899
Other Databases GeneCards:  FRMD6  Malacards:  FRMD6

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0031032 actomyosin structure orga
nization
IBA biological process
GO:0005856 cytoskeleton
IBA cellular component
GO:0005886 plasma membrane
IBA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0043296 apical junction complex
IEA cellular component
GO:0003383 apical constriction
IEA biological process
GO:0034613 cellular protein localiza
tion
IEA biological process
GO:0032970 regulation of actin filam
ent-based process
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04390Hippo signaling pathway
hsa04392Hippo signaling pathway - multiple species
Associated diseases References
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
31037746 Spermatoge
nic defect
s

28 men with az
oospermia
Male infertility Microarray
Show abstract