• Gene id: 122704

Gene Summary

• Gene Symbol: MRPL52   Gene   UCSC   Ensembl
• Gene name: mitochondrial ribosomal protein L52
• Alternate names: 39S ribosomal protein L52, mitochondrial, L52mt, MRP-L52, mitochondrial large ribosomal subunit protein mL52,
• Gene location: 14q11.2 (22829861: 22835036)     Exons: 6     NC_000014.9
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611856

Protein Summary

• Protein general information: Q86TS9  
  • Name: 39S ribosomal protein L52, mitochondrial (L52mt) (MRP L52) (Mitochondrial large ribosomal subunit protein mL52)
  • Length: 123  
  • Mass: 13664
• Sequence:

  MAALGTVLFTGVRRLHCSVAAWAGGQWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAERETFAR
  RVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ

• Structural information:
  • Interpro: IPR034596  
  • PDB: 3J7Y 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J7Y 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000347277
• Other Databases: GeneCards:  MRPL52  Malacards:  MRPL52

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006412	translation	IBA	biological process
GO:0005762	mitochondrial large ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0032543	mitochondrial translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005762	mitochondrial large ribosomal subunit	IEA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	ISS	cellular component
GO:0003735	structural constituent of ribosome	ISS	molecular function
GO:0006412	translation	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881