• Gene id: 122664

Gene Summary

• Gene Symbol: TPPP2   Gene   UCSC   Ensembl
• Aliases: C14orf8, CT152, P18, p25beta
• Gene name: tubulin polymerization promoting protein family member 2
• Alternate names: tubulin polymerization-promoting protein family member 2, TPPP/p18, protein p25-beta,
• Gene location: 14q11.2 (112619774: 112671615)     Exons: 11     NC_000001.11
• OMIM: 616956

Protein Summary

• Protein general information: P59282  
  • Name: Tubulin polymerization promoting protein family member 2 (Protein p25 beta) (TPPP/p18)
  • Length: 170  
  • Mass: 18503
  • Tissue specificity: Expressed in spermatids (PubMed
• Sequence:

  MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVK
  ELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMT
  DNTGYVSGYKGSGTYDKKTK

• Structural information:
  • Interpro: IPR011992  IPR008907  IPR030794  
  • STRING: ENSP00000317595
• Other Databases: GeneCards:  TPPP2  Malacards:  TPPP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042995	cell projection	IEA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031514	motile cilium	IEA	cellular component
GO:1901317	regulation of flagellated sperm motility	IEA	biological process
GO:0036126	sperm flagellum	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0031514	motile cilium	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015631	tubulin binding	IDA	molecular function
GO:0001578	microtubule bundle formation	IMP	NOT|biological process
GO:0015631	tubulin binding	IBA	molecular function
GO:0046785	microtubule polymerization	IBA	biological process
GO:0032273	positive regulation of protein polymerization	IBA	biological process
GO:0005874	microtubule	IBA	colocalizes with
GO:1901317	regulation of flagellated sperm motility	ISS	biological process
GO:1901317	regulation of flagellated sperm motility	IMP	biological process
GO:0036126	sperm flagellum	ISS	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Oligoasthenozoospermia	MIK: 30680919
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
30680919	Oligoasthenozoospermia				Male infertility