• Gene id: 122553

Gene Summary

• Gene Symbol: TRAPPC6B   Gene   UCSC   Ensembl
• Aliases: NEDMEBA, TPC6
• Gene name: trafficking protein particle complex 6B
• Alternate names: trafficking protein particle complex subunit 6B, TRAPP complex subunit 6B,
• Gene location: 14q21.1 (39170399: 39147810)     Exons: 7     NC_000014.9
• Gene summary(Entrez): TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport (Kummel et al., 2005 [PubMed 16025134]).[supplied by OMIM, Mar 2008]
• OMIM: 603577

Protein Summary

• Protein general information: Q86SZ2  
  • Name: Trafficking protein particle complex subunit 6B (TRAPP complex subunit 6B)
  • Length: 158  
  • Mass: 17983
  • Tissue specificity: Both isoforms are expressed ubiquitously (at transcript level), isoform 1 being the most predominant (PubMed
• Sequence:

  MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTT
  VFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACK
  FQVMIQKL

• Structural information:
  • Interpro: IPR024096  IPR007194  IPR037992  
  • CDD: cd14944
  • PDB: 2BJN 2CFH 3KXC
  • PDBsum: 2BJN 2CFH 3KXC
  • DIP: 47626
  • STRING: ENSP00000330289
• Other Databases: GeneCards:  TRAPPC6B  Malacards:  TRAPPC6B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005801	cis-Golgi network	IBA	cellular component
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0030008	TRAPP complex	IBA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0048193	Golgi vesicle transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray