• Gene id: 122509

Gene Summary

• Gene Symbol: IFI27L1   Gene   UCSC   Ensembl
• Aliases: FAM14B, ISG12C
• Gene name: interferon alpha inducible protein 27 like 1
• Alternate names: interferon alpha-inducible protein 27-like protein 1, ISG12(c) protein, family with sequence similarity 14, member B, interferon-stimulated gene 12c protein,
• Gene location: 14q32.12 (94081307: 94102709)     Exons: 8     NC_000014.9
• OMIM: 605853

Protein Summary

• Protein general information: Q96BM0  
  • Name: Interferon alpha inducible protein 27 like protein 1 (Interferon stimulated gene 12c protein) (ISG12(c)) (ISG12C)
  • Length: 104  
  • Mass: 9549
• Sequence:

  MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGGGVAAGSLVAILQSVG
  AAGLSVTSKVIGGFAGTALGAWLGSPPSS

• Structural information:
  • Interpro: IPR009311  IPR038213  
  • PDB: 2LOQ
  • PDBsum: 2LOQ
  • STRING: ENSP00000451851
• Other Databases: GeneCards:  IFI27L1  Malacards:  IFI27L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097190	apoptotic signaling pathway	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0006915	apoptotic process	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray