• Gene id: 121665

Gene Summary

• Gene Symbol: SPPL3   Gene   UCSC   Ensembl
• Aliases: IMP2, MDHV1887, PRO4332, PSH1, PSL4
• Gene name: signal peptide peptidase like 3
• Alternate names: signal peptide peptidase-like 3, SPP-like 3, intramembrane protease 2, presenilin homologous protein 1, presenilin-like protein 4,
• Gene location: 12q24.31 (120904357: 120762509)     Exons: 12     NC_000012.12
• OMIM: 603733

Protein Summary

• Protein general information: Q8TCT6  
  • Name: Signal peptide peptidase like 3 (SPP like 3) (EC 3.4.23. ) (Intramembrane protease 2) (IMP 2) (Presenilin homologous protein 1) (PSH1) (Presenilin like protein 4)
  • Length: 384  
  • Mass: 42261
  • Tissue specificity: Widely expressed (PubMed
• Sequence:

  MAEQTYSWAYSLVDSSQVSTFLISILLIVYGSFRSLNMDFENQDKEKDSNSSSGSFNGNSTNNSIQTIDSTQALF
  LPIGASVSLLVMFFFFDSVQVVFTICTAVLATIAFAFLLLPMCQYLTRPCSPQNKISFGCCGRFTAAELLSFSLS
  VMLVLIWVLTGHWLLMDALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPAD
  NPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQASGDSCGAP
  GPANISGRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWSEPFHSK
  SSSSRFLEV

• Structural information:
  • Interpro: IPR007369  IPR006639  
  • STRING: ENSP00000288680
• Other Databases: GeneCards:  SPPL3  Malacards:  SPPL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071458	integral component of cytoplasmic side of endoplasmic reticulum membrane	IBA	cellular component
GO:0033619	membrane protein proteolysis	IBA	biological process
GO:0030660	Golgi-associated vesicle membrane	IBA	cellular component
GO:0006465	signal peptide processing	IBA	biological process
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	IBA	cellular component
GO:0042500	aspartic endopeptidase activity, intramembrane cleaving	IBA	molecular function
GO:0071458	integral component of cytoplasmic side of endoplasmic reticulum membrane	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0030660	Golgi-associated vesicle membrane	IDA	cellular component
GO:0005791	rough endoplasmic reticulum	IDA	cellular component
GO:0033619	membrane protein proteolysis	IDA	biological process
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	IDA	cellular component
GO:0042500	aspartic endopeptidase activity, intramembrane cleaving	IDA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0006509	membrane protein ectodomain proteolysis	IMP	NOT|biological process
GO:0006509	membrane protein ectodomain proteolysis	IMP	NOT|biological process
GO:0032092	positive regulation of protein binding	ISS	biological process
GO:0042500	aspartic endopeptidase activity, intramembrane cleaving	IMP	molecular function
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	ISS	cellular component
GO:0050852	T cell receptor signaling pathway	ISS	biological process
GO:0035307	positive regulation of protein dephosphorylation	IMP	biological process
GO:0050852	T cell receptor signaling pathway	IMP	biological process
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IMP	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004190	aspartic-type endopeptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0032092	positive regulation of protein binding	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881