• Gene id: 121643

Gene Summary

• Gene Symbol: FOXN4   Gene   UCSC   Ensembl
• Gene name: forkhead box N4
• Alternate names: forkhead box protein N4, forkhead/winged helix transcription factor FOXN4,
• Gene location: 12q24.11 (109309405: 109277977)     Exons: 12     NC_000012.12
• Gene summary(Entrez): Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-amino acid DNA-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helices flanked by 2 large loops
• OMIM: 615496

Protein Summary

• Protein general information: Q96NZ1  
  • Name: Forkhead box protein N4
  • Length: 517  
  • Mass: 55215
• Sequence:

  MIESDTSSIMSGIIRNSGQNHHPSPQEYRLLATTSDDDLPGDLQSLSWLTAVDVPRLQQMASGRVDLGGPCVPHP
  HPGALAGVADLHVGATPSPLLHGPAGMAPRGMPGLGPITGHRDSMSQFPVGGQPSSGLQDPPHLYSPATQPQFPL
  PPGAQQCPPVGLYGPPFGVRPPYPQPHVAVHSSQELHPKHYPKPIYSYSCLIAMALKNSKTGSLPVSEIYSFMKE
  HFPYFKTAPDGWKNSVRHNLSLNKCFEKVENKMSGSSRKGCLWALNLARIDKMEEEMHKWKRKDLAAIHRSMANP
  EELDKLISDRPESCRRPGKPGEPEAPVLTHATTVAVAHGCLAVSQLPPQPLMTLSLQSVPLHHQVQPQAHLAPDS
  PAPAQTPPLHALPDLSPSPLPHPAMGRAPVDFINISTDMNTEVDALDPSIMDFALQGNLWEEMKDEGFSLDTLGA
  FADSPLGCDLGASGLTPASGGSDQSFPDLQVTGLYTAYSTPDSVAASGTSSSSQYLGAQGNKPIALL

• Structural information:
  • Interpro: IPR001766  IPR030456  IPR036388  IPR036390  
  • Prosite: PS00658 PS50039
  • CDD: cd00059
  • STRING: ENSP00000299162
• Other Databases: GeneCards:  FOXN4  Malacards:  FOXN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000987	cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0036302	atrioventricular canal development	ISS	biological process
GO:0035881	amacrine cell differentiation	ISS	biological process
GO:0010842	retina layer formation	ISS	biological process
GO:0008016	regulation of heart contraction	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	ISS	molecular function
GO:0003682	chromatin binding	ISS	molecular function
GO:0001947	heart looping	ISS	biological process
GO:0060579	ventral spinal cord interneuron fate commitment	ISS	biological process
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0000987	cis-regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0010842	retina layer formation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0035881	amacrine cell differentiation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0000987	cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0048663	neuron fate commitment	IEA	biological process
GO:0060579	ventral spinal cord interneuron fate commitment	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq