• Gene id: 121457

Gene Summary

• Gene Symbol: IKBIP   Gene   UCSC   Ensembl
• Aliases: IKIP
• Gene name: IKBKB interacting protein
• Alternate names: inhibitor of nuclear factor kappa-B kinase-interacting protein, I kappa B kinase interacting protein, IKK interacting protein, i kappa-B kinase-interacting protein,
• Gene location: 12q23.1 (98644787: 98613421)     Exons: 4     NC_000012.12

Protein Summary

• Protein general information: Q70UQ0  
  • Name: Inhibitor of nuclear factor kappa B kinase interacting protein (I kappa B kinase interacting protein) (IKBKB interacting protein) (IKK interacting protein)
  • Length: 350  
  • Mass: 39309
  • Tissue specificity: Expressed in vein endothelial cells. Isoform 4 is expressed in lung, kidney, spleen, thymus and skeletal muscle. {ECO
• Sequence:

  MSEVKSRKKSGPKGAPAAEPGKRSEGGKTPVARSSGGGGWADPRTCLSLLSLGTCLGLAWFVFQQSEKFAKVENQ
  YQLLKLETNEFQQLQSKISLISEKWQKSEAIMEQLKSFQIIAHLKRLQEEINEVKTWSNRITEKQDILNNSLTTL
  SQDITKVDQSTTSMAKDVGLKITSVKTDIRRISGLVTDVISLTDSVQELENKIEKVEKNTVKNIGDLLSSSIDRT
  ATLRKTASENSQRINSVKKTLTELKSDFDKHTDRFLSLEGDRAKVLKTVTFANDLKPKVYNLKKDFSRLEPLVND
  LTLRIGRLVTDLLQREKEIAFLSEKISNLTIVQAEIKDIKDEIAHISDMN

• Structural information:
  • Interpro: IPR024152  
• Other Databases: GeneCards:  IKBIP  Malacards:  IKBIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010165	response to X-ray	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray