• Gene id: 121260

Gene Summary

• Gene Symbol: SLC15A4   Gene   UCSC   Ensembl
• Aliases: FP12591, PHT1, PTR4
• Gene name: solute carrier family 15 member 4
• Alternate names: solute carrier family 15 member 4, hPHT1, peptide transporter 4, peptide-histidine transporter 4, peptide/histidine transporter 1, solute carrier family 15 (oligopeptide transporter), member 4,
• Gene location: 12q24.33 (128823965: 128793193)     Exons: 9     NC_000012.12
• OMIM: 615806

Protein Summary

• Protein general information: Q8N697  
  • Name: Solute carrier family 15 member 4 (Peptide transporter 4) (Peptide/histidine transporter 1) (hPHT1)
  • Length: 577  
  • Mass: 62034
  • Tissue specificity: Highly expressed in skeletal muscle. Moderately expressed in kidney, liver, and heart. Weakly expressed in colon and brain. Expressed in low levels throughout the gastrointestinal tract and in Caco-2 cells. Expressed in retinal fragmen
• Sequence:

  MEGSGGGAGERAPLLGARRAAAAAAAAGAFAGRRAACGAVLLTELLERAAFYGITSNLVLFLNGAPFCWEGAQAS
  EALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRAALCGSARLLNCTAPGPDAAA
  RCCSPATFAGLVLVGLGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFVTG
  YAIPTVCVGLAFVVFLCGQSVFITKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCK
  MSHGGPFTEEKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQSLHLRIPEISNITTTPHTLPAAWLTMFDAV
  LILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYHAADLS
  LWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGVGSFVGSGLLALVSIKAIGWMSSHTDFG
  NINGCYLNYYFFLLAAIQGATLLLFLIISVKYDHHRDHQRSRANGVPTSRRA

• Structural information:
  • Interpro: IPR036259  IPR000109  IPR018456  
  • Prosite: PS01023
  • DIP: 60839
  • STRING: ENSP00000266771
• Other Databases: GeneCards:  SLC15A4  Malacards:  SLC15A4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904680	peptide transmembrane transporter activity	IBA	molecular function
GO:0015817	histidine transport	IBA	biological process
GO:0015333	peptide:proton symporter activity	IBA	molecular function
GO:0005290	L-histidine transmembrane transporter activity	IBA	molecular function
GO:0035673	oligopeptide transmembrane transporter activity	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0006857	oligopeptide transport	IEA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0015833	peptide transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0089709	L-histidine transmembrane transport	IEA	biological process
GO:0035672	oligopeptide transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray