• Gene id: 1212

Gene Summary

• Gene Symbol: CLTB   Gene   UCSC   Ensembl
• Aliases: LCB
• Gene name: clathrin light chain B
• Alternate names: clathrin light chain B, clathrin, light chain (Lcb), clathrin, light polypeptide (Lcb),
• Gene location: 5q35.2 (176416568: 176392451)     Exons: 9     NC_000005.10
• Gene summary(Entrez): Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytos
• OMIM: 603963

Protein Summary

• Protein general information: P09497  
  • Name: Clathrin light chain B (Lcb)
  • Length: 229  
  • Mass: 25190
• Sequence:

  MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGD
  VFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKN
  KINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQT
  PLSR

• Structural information:
  • Interpro: IPR000996  
  • Prosite: PS00224 PS00581
  • STRING: ENSP00000309415
• Other Databases: GeneCards:  CLTB  Malacards:  CLTB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045334	clathrin-coated endocytic vesicle	NAS	cellular component
GO:0030125	clathrin vesicle coat	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0030672	synaptic vesicle membrane	IBA	cellular component
GO:0032050	clathrin heavy chain binding	IBA	molecular function
GO:0048268	clathrin coat assembly	IBA	biological process
GO:0072583	clathrin-dependent endocytosis	IBA	biological process
GO:0099631	postsynaptic endocytic zone cytoplasmic component	IBA	cellular component
GO:0005198	structural molecule activity	IEA	molecular function
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0030130	clathrin coat of trans-Golgi network vesicle	IEA	cellular component
GO:0030132	clathrin coat of coated pit	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0005802	trans-Golgi network	IEA	cellular component
GO:0060170	ciliary membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098835	presynaptic endocytic zone membrane	IEA	cellular component
GO:0042277	peptide binding	IEA	molecular function
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0030118	clathrin coat	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0030118	clathrin coat	ISS	cellular component
GO:0030118	clathrin coat	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease
hsa04144	Endocytosis
hsa04142	Lysosome
hsa04721	Synaptic vesicle cycle
hsa05100	Bacterial invasion of epithelial cells
hsa04961	Endocrine and other factor-regulated calcium reabsorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881