• Gene id: 120892

Gene Summary

• Gene Symbol: LRRK2   Gene   UCSC   Ensembl
• Aliases: AURA17, DARDARIN, PARK8, RIPK7, ROCO2
• Gene name: leucine rich repeat kinase 2
• Alternate names: leucine-rich repeat serine/threonine-protein kinase 2, augmented in rheumatoid arthritis 17,
• Gene location: 12q12 (40224889: 40369284)     Exons: 54     NC_000012.12
• Gene summary(Entrez): This gene is a member of the leucine-rich repeat kinase family and encodes a protein with an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a MLK-like domain, and a WD40 domain.

Protein Summary

• Protein general information: Q5S007  
  • Name: Leucine rich repeat serine/threonine protein kinase 2 (EC 2.7.11.1) (EC 3.6.5. ) (Dardarin)
  • Length: 2527  
  • Mass: 286103
  • Tissue specificity: Expressed in pyramidal neurons in all cortical laminae of the visual cortex, in neurons of the substantia nigra pars compacta and caudate putamen (at protein level). Expressed in neutrophils (at protein level) (PubMed
• Sequence:

  MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDSYMRVA
  SVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITL
  LILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHV
  LHCLHSLAIPCNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQ
  QYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALN
  NLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQ
  KHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTE
  FHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQ
  EIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVI
  FHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCE
  KESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDK
  TSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEG
  SFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSIS
  SLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFTSF
  PSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSP
  LRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRS
  LDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDV
  SYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTL
  LQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQ
  AEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKL
  RKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHF
  LNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYF
  KLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRER
  ALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDI
  CGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDEL
  EFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELA
  SKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCC
  RMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYG
  CAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLGCGHTD
  RGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYC
  NSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFS
  FSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKE
  NKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGY
  NRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE

• Structural information:
  • Protein Domains: (1328..151-)
    (/note="Roc-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00758-)
    (1879..213-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR036770  IPR011989  IPR016024  IPR032171  IPR011009   IPR001611  IPR003591  IPR032675  IPR027417  IPR000719  IPR017441  IPR020859  IPR008271  IPR005225  IPR015943  IPR036322  
  • Prosite: PS51450 PS00107 PS50011 PS00108 PS51424
  • PDB: 2ZEJ 3D6T 5MY9 5MYC 6DLO 6DLP
  • PDBsum: 2ZEJ 3D6T 5MY9 5MYC 6DLO 6DLP
  • DIP: 29684
  • STRING: ENSP00000298910
• Other Databases: GeneCards:  LRRK2  Malacards:  LRRK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:1903217	negative regulation of protein processing involved in protein targeting to mitochondrion	IC	biological process
GO:0030159	signaling receptor complex adaptor activity	IC	molecular function
GO:0036479	peroxidase inhibitor activity	IDA	molecular function
GO:1901215	negative regulation of neuron death	IGI	biological process
GO:2000300	regulation of synaptic vesicle exocytosis	IMP	biological process
GO:0043406	positive regulation of MAP kinase activity	IC	biological process
GO:1990909	Wnt signalosome	IDA	cellular component
GO:0003779	actin binding	IPI	molecular function
GO:0008017	microtubule binding	TAS	molecular function
GO:1904713	beta-catenin destruction complex binding	NAS	molecular function
GO:0051018	protein kinase A binding	IPI	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005798	Golgi-associated vesicle	IDA	cellular component
GO:0005902	microvillus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043005	neuron projection	IDA	cellular component
GO:0007005	mitochondrion organization	IMP	biological process
GO:0007040	lysosome organization	IMP	biological process
GO:0017075	syntaxin-1 binding	IPI	molecular function
GO:0005525	GTP binding	TAS	molecular function
GO:0016301	kinase activity	IMP	molecular function
GO:0044325	ion channel binding	IPI	molecular function
GO:0044754	autolysosome	IDA	cellular component
GO:2000172	regulation of branching morphogenesis of a nerve	IMP	biological process
GO:0035751	regulation of lysosomal lumen pH	IMP	biological process
GO:1902692	regulation of neuroblast proliferation	IMP	biological process
GO:1902803	regulation of synaptic vesicle transport	TAS	biological process
GO:1902803	regulation of synaptic vesicle transport	ISS	biological process
GO:0099400	caveola neck	IDA	cellular component
GO:0032092	positive regulation of protein binding	IDA	biological process
GO:1990909	Wnt signalosome	NAS	cellular component
GO:1903215	negative regulation of protein targeting to mitochondrion	IDA	biological process
GO:1901214	regulation of neuron death	IMP	biological process
GO:0006897	endocytosis	IGI	biological process
GO:0006897	endocytosis	IMP	biological process
GO:1902499	positive regulation of protein autoubiquitination	IDA	biological process
GO:1903125	negative regulation of thioredoxin peroxidase activity by peptidyl-threonine phosphorylation	IDA	biological process
GO:0000149	SNARE binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0043195	terminal bouton	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1905289	regulation of CAMKK-AMPK signaling cascade	IMP	biological process
GO:1905279	regulation of retrograde transport, endosome to Golgi	IGI	biological process
GO:0030426	growth cone	IDA	cellular component
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0039706	co-receptor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IMP	biological process
GO:0001933	negative regulation of protein phosphorylation	ISS	biological process
GO:0097487	multivesicular body, internal vesicle	IDA	cellular component
GO:0006468	protein phosphorylation	IMP	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0010506	regulation of autophagy	IMP	biological process
GO:0014041	regulation of neuron maturation	IMP	biological process
GO:0051646	mitochondrion localization	IMP	biological process
GO:0000187	activation of MAPK activity	IMP	biological process
GO:0070585	protein localization to mitochondrion	TAS	biological process
GO:0021772	olfactory bulb development	IMP	biological process
GO:0030276	clathrin binding	IPI	molecular function
GO:0010955	negative regulation of protein processing	IDA	biological process
GO:0044753	amphisome	IDA	cellular component
GO:0009267	cellular response to starvation	IMP	biological process
GO:1903206	negative regulation of hydrogen peroxide-induced cell death	IMP	biological process
GO:1903351	cellular response to dopamine	IMP	biological process
GO:0035556	intracellular signal transduction	ISS	biological process
GO:1902902	negative regulation of autophagosome assembly	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:1904887	Wnt signalosome assembly	TAS	biological process
GO:1904887	Wnt signalosome assembly	IPI	biological process
GO:1902823	negative regulation of late endosome to lysosome transport	TAS	biological process
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0032091	negative regulation of protein binding	IMP	biological process
GO:0016234	inclusion body	IMP	cellular component
GO:0051900	regulation of mitochondrial depolarization	IMP	biological process
GO:0060079	excitatory postsynaptic potential	ISS	biological process
GO:0060159	regulation of dopamine receptor signaling pathway	ISS	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0061001	regulation of dendritic spine morphogenesis	IMP	biological process
GO:0061001	regulation of dendritic spine morphogenesis	ISS	biological process
GO:0090140	regulation of mitochondrial fission	TAS	biological process
GO:0010738	regulation of protein kinase A signaling	ISS	biological process
GO:0016242	negative regulation of macroautophagy	IMP	biological process
GO:0016310	phosphorylation	IMP	biological process
GO:0018107	peptidyl-threonine phosphorylation	IMP	biological process
GO:0019722	calcium-mediated signaling	IMP	biological process
GO:0051966	regulation of synaptic transmission, glutamatergic	ISS	biological process
GO:0060070	canonical Wnt signaling pathway	TAS	biological process
GO:0071287	cellular response to manganese ion	IMP	biological process
GO:0072593	reactive oxygen species metabolic process	IMP	biological process
GO:0022028	tangential migration from the subventricular zone to the olfactory bulb	IMP	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IGI	biological process
GO:0090394	negative regulation of excitatory postsynaptic potential	ISS	biological process
GO:0034613	cellular protein localization	ISS	biological process
GO:0000149	SNARE binding	IBA	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0007029	endoplasmic reticulum organization	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0010508	positive regulation of autophagy	IBA	biological process
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0042391	regulation of membrane potential	IBA	biological process
GO:0043204	perikaryon	IBA	cellular component
GO:0048812	neuron projection morphogenesis	IBA	biological process
GO:0060159	regulation of dopamine receptor signaling pathway	IBA	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0061001	regulation of dendritic spine morphogenesis	IBA	biological process
GO:0070971	endoplasmic reticulum exit site	IBA	cellular component
GO:0071407	cellular response to organic cyclic compound	IBA	biological process
GO:1902902	negative regulation of autophagosome assembly	IBA	biological process
GO:0005764	lysosome	IBA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0007005	mitochondrion organization	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0017048	Rho GTPase binding	IBA	molecular function
GO:0030424	axon	IBA	cellular component
GO:0045121	membrane raft	IBA	cellular component
GO:0051018	protein kinase A binding	IBA	molecular function
GO:0070973	protein localization to endoplasmic reticulum exit site	IBA	biological process
GO:1902803	regulation of synaptic vesicle transport	IBA	biological process
GO:1905279	regulation of retrograde transport, endosome to Golgi	IBA	biological process
GO:0030425	dendrite	IDA	cellular component
GO:0030424	axon	IDA	cellular component
GO:0016301	kinase activity	IDA	molecular function
GO:0043204	perikaryon	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0070971	endoplasmic reticulum exit site	IDA	cellular component
GO:0031410	cytoplasmic vesicle	ISS	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005768	endosome	ISS	cellular component
GO:0005764	lysosome	ISS	cellular component
GO:0044325	ion channel binding	IPI	molecular function
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0060628	regulation of ER to Golgi vesicle-mediated transport	ISS	biological process
GO:0070973	protein localization to endoplasmic reticulum exit site	IMP	biological process
GO:0005759	mitochondrial matrix	ISS	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005741	mitochondrial outer membrane	ISS	cellular component
GO:0048812	neuron projection morphogenesis	IMP	biological process
GO:0043204	perikaryon	ISS	cellular component
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007029	endoplasmic reticulum organization	IMP	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0034260	negative regulation of GTPase activity	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904469	positive regulation of tumor necrosis factor secretion	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:1901727	positive regulation of histone deacetylase activity	IEA	biological process
GO:1900242	regulation of synaptic vesicle endocytosis	IEA	biological process
GO:0090394	negative regulation of excitatory postsynaptic potential	IEA	biological process
GO:0070971	endoplasmic reticulum exit site	IEA	cellular component
GO:0061001	regulation of dendritic spine morphogenesis	IEA	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0060159	regulation of dopamine receptor signaling pathway	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0051966	regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0035564	regulation of kidney size	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0034613	cellular protein localization	IEA	biological process
GO:0010738	regulation of protein kinase A signaling	IEA	biological process
GO:0010508	positive regulation of autophagy	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0007030	Golgi organization	IEA	biological process
GO:0007029	endoplasmic reticulum organization	IEA	biological process
GO:0006606	protein import into nucleus	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:1903980	positive regulation of microglial cell activation	IEA	biological process
GO:1900244	positive regulation of synaptic vesicle endocytosis	IEA	biological process
GO:0140058	neuron projection arborization	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0021756	striatum development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:1990909	Wnt signalosome	IEA	cellular component
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:1904713	beta-catenin destruction complex binding	IEA	molecular function
GO:1902803	regulation of synaptic vesicle transport	IEA	biological process
GO:0099523	presynaptic cytosol	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0070973	protein localization to endoplasmic reticulum exit site	IEA	biological process
GO:0060628	regulation of ER to Golgi vesicle-mediated transport	IEA	biological process
GO:0051018	protein kinase A binding	IEA	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0035641	locomotory exploration behavior	IEA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0017048	Rho GTPase binding	IEA	molecular function
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005802	trans-Golgi network	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0003924	GTPase activity	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0015631	tubulin binding	IDA	molecular function
GO:0034211	GTP-dependent protein kinase activity	IDA	molecular function
GO:0017048	Rho GTPase binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004708	MAP kinase kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0043005	neuron projection	IDA	cellular component
GO:0007528	neuromuscular junction development	IMP	biological process
GO:0008340	determination of adult lifespan	IMP	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0000186	activation of MAPKK activity	IDA	biological process
GO:0046039	GTP metabolic process	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0032839	dendrite cytoplasm	IDA	cellular component
GO:0043025	neuronal cell body	IDA	cellular component
GO:0043025	neuronal cell body	IDA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0006979	response to oxidative stress	IMP	biological process
GO:0010508	positive regulation of autophagy	ISS	biological process
GO:0035564	regulation of kidney size	ISS	biological process
GO:0035640	exploration behavior	IMP	biological process
GO:0040012	regulation of locomotion	IMP	biological process
GO:0042391	regulation of membrane potential	IMP	biological process
GO:0048312	intracellular distribution of mitochondria	IMP	biological process
GO:0060161	positive regulation of dopamine receptor signaling pathway	IMP	biological process
GO:0070997	neuron death	IMP	biological process
GO:0005768	endosome	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0032473	cytoplasmic side of mitochondrial outer membrane	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0000165	MAPK cascade	IDA	biological process
GO:0005525	GTP binding	IDA	molecular function
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0043068	positive regulation of programmed cell death	IDA	biological process
GO:0005525	GTP binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0031647	regulation of protein stability	IMP	biological process
GO:0005737	cytoplasm	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function
GO:0006468	protein phosphorylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000287	magnesium ion binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046777	protein autophosphorylation	IMP	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0034211	GTP-dependent protein kinase activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05012	Parkinson disease

Diseases

Associated diseases	References
Parkinson disease	KEGG:H00057
Parkinsonian syndrome	KEGG:H01600
Lewy body dementia	KEGG:H00066
Parkinson disease	KEGG:H00057
Parkinsonian syndrome	KEGG:H01600
Lewy body dementia	KEGG:H00066
Parkinson's disease	PMID:21796139
Parkinson's disease	PMID:20720502
Parkinson's disease	PMID:26223426
Cancer	PMID:20818610
Amyotrophic lateral sclerosis	PMID:21375368
Rheumatoid arthritis	PMID:17082220
Crohn's disease	PMID:21983832
Frontotemporal dementia	PMID:17639429
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R