• Gene id: 1208

Gene Summary

• Gene Symbol: CLPS   Gene   UCSC   Ensembl
• Gene name: colipase
• Alternate names: colipase, colipase, pancreatic, pancreatic colipase preproprotein,
• Gene location: 6p21.31 (35797343: 35794981)     Exons: 27     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a cofactor needed by pancreatic lipase for efficient dietary lipid hydrolysis. It binds to the C-terminal, non-catalytic domain of lipase, thereby stabilizing an active conformation and considerably increasing the overa
• OMIM: 120105

Protein Summary

• Protein general information: P04118  
  • Name: Colipase
  • Length: 112  
  • Mass: 11954
  • Tissue specificity: Expressed by the pancreas.
• Sequence:

  MEKILILLLVALSVAYAAPGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIY
  YKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ

• Structural information:
  • Interpro: IPR001981  IPR017914  IPR017915  IPR017913  
  • Prosite: PS00121 PS51342
  • CDD: cd00039
  • STRING: ENSP00000259938
• Other Databases: GeneCards:  CLPS  Malacards:  CLPS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032094	response to food	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007586	digestion	IEA	biological process
GO:0008047	enzyme activator activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007586	digestion	IEA	biological process
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	NAS	biological process
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0044241	lipid digestion	TAS	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
type 2 diabetes mellitus	PMID:16189801
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881