• Gene id: 120526

Gene Summary

• Gene Symbol: DNAJC24   Gene   UCSC   Ensembl
• Aliases: DPH4, JJJ3, ZCSL3
• Gene name: DnaJ heat shock protein family (Hsp40) member C24
• Alternate names: dnaJ homolog subfamily C member 24, 1700030A21Rik, CSL-type zinc finger-containing protein 3, DPH4 homolog (JJJ3, S. cerevisiae), DPH4, JJJ3 homolog, DnaJ (Hsp40) homolog, subfamily C, member 24, diphthamide biosynthesis protein 4, zinc finger, CSL domain contai,
• Gene location: 11p13 (31369839: 31432834)     Exons: 8     NC_000011.10
• Gene summary(Entrez): Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of
• OMIM: 611072

Protein Summary

• Protein general information: Q6P3W2  
  • Name: DnaJ homolog subfamily C member 24 (CSL type zinc finger containing protein 3) (Diphthamide biosynthesis protein 4)
  • Length: 149  
  • Mass: 17139
• Sequence:

  MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETK
  REYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN

• Structural information:
  • Protein Domains: (11..8-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286-)
    (93..14-)
    (/note="DPH-type-MB)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00456"-)
  • Interpro: IPR001623  IPR042978  IPR036869  IPR007872  IPR036671  
  • Prosite: PS50076 PS51074
  • CDD: cd06257
  • PDB: 2L6L
  • PDBsum: 2L6L
  • STRING: ENSP00000417548
• Other Databases: GeneCards:  DNAJC24  Malacards:  DNAJC24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001671	ATPase activator activity	IBA	molecular function
GO:0008198	ferrous iron binding	IBA	molecular function
GO:0032781	positive regulation of ATPase activity	IBA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0032781	positive regulation of ATPase activity	IDA	biological process
GO:0008198	ferrous iron binding	IDA	molecular function
GO:0001671	ATPase activator activity	IDA	molecular function
GO:0061077	chaperone-mediated protein folding	TAS	biological process
GO:0001671	ATPase activator activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0017183	peptidyl-diphthamide biosynthetic process from peptidyl-histidine	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R