• Gene id: 120425

Gene Summary

• Gene Symbol: JAML   Gene   UCSC   Ensembl
• Aliases: AMICA, AMICA1, CREA7-1, CREA7-4, Gm638
• Gene name: junction adhesion molecule like
• Alternate names: junctional adhesion molecule-like, adhesion molecule AMICA, adhesion molecule interacting with CXADR antigen 1, adhesion molecule, interacts with CXADR antigen 1, dendritic-cell specific protein CREA7-1, dendritic-cell specific protein CREA7-4,
• Gene location: 11q23.3 (118225088: 118193724)     Exons: 13     NC_000011.10
• OMIM: 604084

Protein Summary

• Protein general information: Q86YT9  
  • Name: Junctional adhesion molecule like (Adhesion molecule interacting with CXADR antigen 1) (Dendritic cell specific protein CREA7 1)
  • Length: 394  
  • Mass: 44339
  • Tissue specificity: Expression is restricted to the hematopoietic tissues with the exception of liver. Expressed in fetal liver, spleen and thymus. Preferentially expressed by mature leukocytes (at protein level). {ECO
• Sequence:

  MFCPLKLILLPVLLDYSLGLNDLNVSPPELTVHVGDSALMGCVFQSTEDKCIFKIDWTLSPGEHAKDEYVLYYYS
  NLSVPIGRFQNRVHLMGDILCNDGSLLLQDVQEADQGTYICEIRLKGESQVFKKAVVLHVLPEEPKELMVHVGGL
  IQMGCVFQSTEVKHVTKVEWIFSGRRAKEEIVFRYYHKLRMSVEYSQSWGHFQNRVNLVGDIFRNDGSIMLQGVR
  ESDGGNYTCSIHLGNLVFKKTIVLHVSPEEPRTLVTPAALRPLVLGGNQLVIIVGIVCATILLLPVLILIVKKTC
  GNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEATYMTMHPVWPSLRSDR
  NNSLEKKSGGGMPKTQQAF

• Structural information:
  • Protein Domains: (20..13-)
    1 (/note="Ig-like-V-type)
    (137..25-)
    2" (/note="Ig-like-V-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106   IPR029871  IPR000920  
  • Prosite: PS50835
  • STRING: ENSP00000348635
• Other Databases: GeneCards:  JAML  Malacards:  JAML

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0060054	positive regulation of epithelial cell proliferation involved in wound healing	ISS	biological process
GO:0046629	gamma-delta T cell activation	ISS	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	biological process
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0035696	monocyte extravasation	IMP	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0046629	gamma-delta T cell activation	IEA	biological process
GO:0050900	leukocyte migration	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005923	bicellular tight junction	IDA	cellular component
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IDA	biological process
GO:0072672	neutrophil extravasation	IMP	biological process
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0030593	neutrophil chemotaxis	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881