• Gene id: 120376

Gene Summary

• Gene Symbol: COLCA2   Gene   UCSC   Ensembl
• Aliases: C11orf93, CASC13, LOH11CR1G
• Gene name: colorectal cancer associated 2
• Alternate names: colorectal cancer-associated protein 2, cancer susceptibility candidate 13, cancer susceptibility candidate protein 13, colorectal cancer associated two,
• Gene location: 11q23.1 (111298348: 111308734)     Exons: 10     NC_000011.10

Protein Summary

• Protein general information: A8K830  
  • Name: Colorectal cancer associated protein 2 (Cancer susceptibility candidate protein 13)
  • Length: 154  
  • Mass: 16850
  • Tissue specificity: Expressed in many cell types of epithelial, mesenchymal and hematopoietic origins. {ECO
• Sequence:

  MHPEPLLNSTQSAPHHFPDSFQATPFCFNQSLIPGSPSNSSILSGSLDYSYSPVQLPSYAPENYNSPASLDTRTC
  GYPPEDHSYQHLSSHAQYSCFSSATTSICYCASCEAEDLDALQAAEYFYPSTDCVDFAPSAAATSDFYKRETNCD
  ICYS

• Structural information:
  • STRING: ENSP00000484135
• Other Databases: GeneCards:  COLCA2  Malacards:  COLCA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray