• Gene id: 120103

Gene Summary

• Gene Symbol: SLC36A4   Gene   UCSC   Ensembl
• Aliases: PAT4
• Gene name: solute carrier family 36 member 4
• Alternate names: proton-coupled amino acid transporter 4, solute carrier family 36 (proton/amino acid symporter), member 4,
• Gene location: 11q21 (93386037: 93144173)     Exons: 15     NC_000011.10
• Gene summary(Entrez): SLC36A4 belongs to the SLC36 family of amino acid transporters based on sequence similarity with other family members (e.g., SLC36A1; MIM 606561). SLC36 proteins contain about 500 amino acids and have 9 to 11 transmembrane domains. Unlike other SLC36 fami
• OMIM: 613760

Protein Summary

• Protein general information: Q6YBV0  
  • Name: Proton coupled amino acid transporter 4 (Proton/amino acid transporter 4) (Solute carrier family 36 member 4)
  • Length: 504  
  • Mass: 56157
• Sequence:

  MEAAATPAAAGAARREELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGT
  GLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCLRFKKSTLGYSDTVSFAMEVSPWSCLQKQAAW
  GRSVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLESKVFISNSTNSSNPCERRSVDLRIYMLCFLPFIILLVF
  IRELKNLFVLSFLANVSMAVSLVIIYQYVVRNMPDPHNLPIVAGWKKYPLFFGTAVFAFEGIGVVLPLENQMKES
  KRFPQALNIGMGIVTTLYVTLATLGYMCFHDEIKGSITLNLPQDVWLYQSVKILYSFGIFVTYSIQFYVPAEIII
  PGITSKFHTKWKQICEFGIRSFLVSITCAGAILIPRLDIVISFVGAVSSSTLALILPPLVEILTFSKEHYNIWMV
  LKNISIAFTGVVGFLLGTYITVEEIIYPTPKVVAGTPQSPFLNLNSTCLTSGLK

• Structural information:
  • Interpro: IPR013057  
  • STRING: ENSP00000317382
• Other Databases: GeneCards:  SLC36A4  Malacards:  SLC36A4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015193	L-proline transmembrane transporter activity	IBA	molecular function
GO:0015808	L-alanine transport	IBA	biological process
GO:0003333	amino acid transmembrane transport	IBA	biological process
GO:0005774	vacuolar membrane	IBA	cellular component
GO:0015171	amino acid transmembrane transporter activity	IBA	molecular function
GO:0015180	L-alanine transmembrane transporter activity	IBA	molecular function
GO:0006865	amino acid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015193	L-proline transmembrane transporter activity	EXP	molecular function
GO:0015196	L-tryptophan transmembrane transporter activity	EXP	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:1904556	L-tryptophan transmembrane transport	TAS	biological process
GO:1904271	L-proline import across plasma membrane	TAS	biological process
GO:0015180	L-alanine transmembrane transporter activity	IDA	molecular function
GO:0015196	L-tryptophan transmembrane transporter activity	IDA	molecular function
GO:0015193	L-proline transmembrane transporter activity	IDA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015824	proline transport	IDA	biological process
GO:0015827	tryptophan transport	IDA	biological process
GO:0015808	L-alanine transport	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray