• Gene id: 119710

Gene Summary

• Gene Symbol: IFTAP   Gene   UCSC   Ensembl
• Aliases: C11orf74, HEPIS, NWC
• Gene name: intraflagellar transport associated protein
• Alternate names: intraflagellar transport-associated protein, protein C11orf74, uncharacterized protein C11orf74,
• Gene location: 11p12 (36594245: 36659290)     Exons: 8     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein that was identified as a cellular interacting partner of non-structural protein 10 of the severe acute respiratory syndrome coronavirus (SARS-CoV). The encoded protein may function as a negative regulator of transcription. Ther

Protein Summary

• Protein general information: Q86VG3  
  • Name: Intraflagellar transport associated protein (Protein HEPIS)
  • Length: 221  
  • Mass: 25407
• Sequence:

  MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVTHKNEA
  DDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCIPFVAQPPTCE
  VKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD

• Structural information:
  • Interpro: IPR040028  
  • STRING: ENSP00000403937
• Other Databases: GeneCards:  IFTAP  Malacards:  IFTAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0120160	intraciliary transport particle A binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097731	9+0 non-motile cilium	IEA	cellular component
GO:0009566	fertilization	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0120160	intraciliary transport particle A binding	IEA	molecular function
GO:0007340	acrosome reaction	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)