About Us

Search Result


Gene id 1196
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol CLK2   Gene   UCSC   Ensembl
Gene name CDC like kinase 2
Alternate names dual specificity protein kinase CLK2, CLK kinase,
Gene location 1q22 (49373803: 49399430)     Exons: 5     NC_000016.10
Gene summary(Entrez) This gene encodes a dual specificity protein kinase that phosphorylates serine/threonine and tyrosine-containing substrates. Activity of this protein regulates serine- and arginine-rich (SR) proteins of the spliceosomal complex, thereby influencing altern
OMIM 602989

Protein Summary

Protein general information P49760  

Name: Dual specificity protein kinase CLK2 (EC 2.7.12.1) (CDC like kinase 2)

Length: 499  Mass: 60090

Tissue specificity: Endothelial cells (PubMed

Sequence MPHPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDRRVYDRRYCG
SYRRNDYSRDRGDAYYDTDYRHSYEYQRENSSYRSQRSSRRKHRRRRRRSRTFSRSSSQHSSRRAKSVEDDAEGH
LIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNL
CVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVN
SDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYY
VGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEEHH
QLFDLIESMLEYEPAKRLTLGEALQHPFFARLRAEPPNKLWDSSRDISR
Structural information
Protein Domains
(163..47-)
(/note="Protein-kinase)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
Interpro:  IPR011009  IPR000719  IPR017441  IPR008271  
Prosite:   PS00107 PS50011 PS00108

PDB:  
3NR9 5UNP 6FYI 6FYK 6FYL 6KHE
PDBsum:   3NR9 5UNP 6FYI 6FYK 6FYL 6KHE

DIP:  

42277

MINT:  
STRING:   ENSP00000357345
Other Databases GeneCards:  CLK2  Malacards:  CLK2

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0043484 regulation of RNA splicin
g
IDA biological process
GO:0006468 protein phosphorylation
IDA biological process
GO:0006468 protein phosphorylation
IDA biological process
GO:0005634 nucleus
IDA cellular component
GO:0004674 protein serine/threonine
kinase activity
IDA molecular function
GO:0005634 nucleus
IDA cellular component
GO:0006468 protein phosphorylation
IDA biological process
GO:0046777 protein autophosphorylati
on
ISS biological process
GO:0045721 negative regulation of gl
uconeogenesis
ISS biological process
GO:0010212 response to ionizing radi
ation
IMP biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0004672 protein kinase activity
IEA molecular function
GO:0005524 ATP binding
IEA molecular function
GO:0006468 protein phosphorylation
IEA biological process
GO:0016301 kinase activity
IEA molecular function
GO:0016740 transferase activity
IEA molecular function
GO:0004713 protein tyrosine kinase a
ctivity
IEA molecular function
GO:0005524 ATP binding
IEA molecular function
GO:0000166 nucleotide binding
IEA molecular function
GO:0004674 protein serine/threonine
kinase activity
IEA molecular function
GO:0016310 phosphorylation
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0004674 protein serine/threonine
kinase activity
TAS molecular function
GO:0004712 protein serine/threonine/
tyrosine kinase activity
IEA molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0004713 protein tyrosine kinase a
ctivity
IEA molecular function
GO:0010033 response to organic subst
ance
IEA biological process
GO:0018108 peptidyl-tyrosine phospho
rylation
IEA biological process
GO:0046777 protein autophosphorylati
on
IEA biological process
GO:0004674 protein serine/threonine
kinase activity
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0006468 protein phosphorylation
IEA biological process
GO:0032526 response to retinoic acid
IEA biological process
GO:0045721 negative regulation of gl
uconeogenesis
IEA biological process
GO:0016607 nuclear speck
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0016604 nuclear body
IDA cellular component
Associated diseases References
Hypospermatogenesis MIK: 28361989
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
28361989 Hyposperma
togenesis

6 (3 controls,
3 Klienfelter s
yndrome
Male infertility Microarray
Show abstract
31037746 Spermatoge
nic defect
s

28 men with az
oospermia
Male infertility Microarray
Show abstract