• Gene id: 1195

Gene Summary

• Gene Symbol: CLK1   Gene   UCSC   Ensembl
• Aliases: CLK, CLK/STY, STY
• Gene name: CDC like kinase 1
• Alternate names: dual specificity protein kinase CLK1, CDC28/CDC2-like kinase, protein tyrosine kinase STY,
• Gene location: 2q33.1 (200864657: 200853008)     Exons: 14     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the CDC2-like (or LAMMER) family of dual specificity protein kinases. In the nucleus, the encoded protein phosphorylates serine/arginine-rich proteins involved in pre-mRNA processing, releasing them into the nucleoplasm. The
• OMIM: 601951

Protein Summary

• Protein general information: P49759  
  • Name: Dual specificity protein kinase CLK1 (EC 2.7.12.1) (CDC like kinase 1)
  • Length: 484  
  • Mass: 57291
  • Tissue specificity: Endothelial cells. {ECO
• Sequence:

  MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESRSINEKDYHSRRYIDE
  YRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIHHSTSHRRSHGKSHRRKRTRSVEDDEEGHLI
  CQSGDVLSARYEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSTFRCV
  QMLEWFEHHGHICIVFELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
  YTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLG
  FTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDVEHERL
  FDLIQKMLEYDPAKRITLREALKHPFFDLLKKSI

• Structural information:
  • Protein Domains: (161..47-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 1Z57 2VAG 5J1V 5J1W 5X8I 6FT8 6FT9 6FYO 6G33 6I5H 6I5I 6I5K 6I5L 6KHD 6Q8K 6Q8P 6RAA
  • PDBsum: 1Z57 2VAG 5J1V 5J1W 5X8I 6FT8 6FT9 6FYO 6G33 6I5H 6I5I 6I5K 6I5L 6KHD 6Q8K 6Q8P 6RAA
  • STRING: ENSP00000394734
• Other Databases: GeneCards:  CLK1  Malacards:  CLK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0043484	regulation of RNA splicing	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	TAS	molecular function
GO:0004712	protein serine/threonine/tyrosine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0018107	peptidyl-threonine phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05134	Legionellosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq