• Gene id: 119392

Gene Summary

• Gene Symbol: SFR1   Gene   UCSC   Ensembl
• Aliases: C10orf78, MEI5, MEIR5, bA373N18.1
• Gene name: SWI5 dependent homologous recombination repair protein 1
• Alternate names: swi5-dependent recombination DNA repair protein 1 homolog, MEI5 recombination repair protein homolog, SWI5-dependent recombination repair 1, SWI5-dependent recombination repair protein 1, meiosis protein 5 homolog,
• Gene location: 10q25.1 (104122057: 104126384)     Exons: 6     NC_000010.11
• OMIM: 616527

Protein Summary

• Protein general information: Q86XK3  
  • Name: Swi5 dependent recombination DNA repair protein 1 homolog (Meiosis protein 5 homolog)
  • Length: 245  
  • Mass: 28262
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MAEGEKNQDFTFKMESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVE
  SEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQSLDSGSCSALQNEFVSEKLPKQ
  RLNAEKAKLVKQVQEKEDLLRRLKLVKMYRSKNDLSQLQLLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDH
  YGLDDKLLHYNRSEEEFIDV

• Structural information:
  • Interpro: IPR042429  IPR018468  
  • STRING: ENSP00000358742
• Other Databases: GeneCards:  SFR1  Malacards:  SFR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032798	Swi5-Sfr1 complex	IBA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IBA	molecular function
GO:0032798	Swi5-Sfr1 complex	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0071391	cellular response to estrogen stimulus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0030374	nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032798	Swi5-Sfr1 complex	IEA	cellular component
GO:0000724	double-strand break repair via homologous recombination	IEA	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)