• Gene id: 119391

Gene Summary

• Gene Symbol: GSTO2   Gene   UCSC   Ensembl
• Aliases: GSTO 2-2, bA127L20.1
• Gene name: glutathione S-transferase omega 2
• Alternate names: glutathione S-transferase omega-2, GSTO-2, MMA(V) reductase, bA127L20.1 (novel glutathione-S-transferase), glutathione S-transferase omega 2-2, glutathione-S-transferase-like protein, glutathione-dependent dehydroascorbate reductase, monomethylarsonic acid reduc,
• Gene location: 10q25.1 (104267625: 104304949)     Exons: 4     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is an omega class glutathione S-transferase (GST). GSTs are involved in the metabolism of xenobiotics and carcinogens. Four transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq,
• OMIM: 612314

Protein Summary

• Protein general information: Q9H4Y5  
  • Name: Glutathione S transferase omega 2 (GSTO 2) (EC 2.5.1.18) (Glutathione S transferase omega 2 2) (GSTO 2 2) (Glutathione dependent dehydroascorbate reductase) (EC 1.8.5.1) (Monomethylarsonic acid reductase) (MMA(V) reductase) (EC 1.20.4.2)
  • Length: 243  
  • Mass: 28254
  • Tissue specificity: Expressed in a range of tissues, including the liver, kidney, skeletal muscle and prostate. Strongest expression in the testis. {ECO
• Sequence:

  MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVL
  ETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQE
  FSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQG
  FLNLYFQNNPNAFDFGLC

• Structural information:
  • Protein Domains: (22..10-)
    (/note="GST-N-terminal)
    (106..23-)
    (/note="GST-C-terminal")
  • Interpro: IPR010987  IPR036282  IPR040079  IPR004045  IPR005442   IPR036249  
  • Prosite: PS50405 PS50404
  • PDB: 3Q18 3Q19 3QAG
  • PDBsum: 3Q18 3Q19 3QAG
  • STRING: ENSP00000345023
• Other Databases: GeneCards:  GSTO2  Malacards:  GSTO2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0045174	glutathione dehydrogenase (ascorbate) activity	IBA	molecular function
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0045174	glutathione dehydrogenase (ascorbate) activity	IDA	molecular function
GO:0019852	L-ascorbic acid metabolic process	IDA	biological process
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0071243	cellular response to arsenic-containing substance	IDA	biological process
GO:0016491	oxidoreductase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0045174	glutathione dehydrogenase (ascorbate) activity	IEA	molecular function
GO:0050610	methylarsonate reductase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019852	L-ascorbic acid metabolic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05200	Pathways in cancer
hsa05225	Hepatocellular carcinoma
hsa05418	Fluid shear stress and atherosclerosis
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa01524	Platinum drug resistance
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Alzheimer's disease	PMID:14570706
Parkinson's disease	PMID:14570706
Asthma	PMID:20374258
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)