• Gene id: 1192

Gene Summary

• Gene Symbol: CLIC1   Gene   UCSC   Ensembl
• Aliases: CL1C1, CLCNL1, G6, NCC27
• Gene name: chloride intracellular channel 1
• Alternate names: chloride intracellular channel protein 1, RNCC protein, chloride channel ABP, hRNCC, nuclear chloride ion channel 27, nuclear chloride ion channel protein, p64CLCP, regulatory nuclear chloride ion channel protein,
• Gene location: 6p21.33 (31737317: 31730580)     Exons: 7     NC_000006.12
• Gene summary(Entrez): Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracel
• OMIM: 118930

Protein Summary

• Protein general information: O00299  
  • Name: Chloride intracellular channel protein 1 (Chloride channel ABP) (Nuclear chloride ion channel 27) (NCC27) (Regulatory nuclear chloride ion channel protein) (hRNCC)
  • Length: 241  
  • Mass: 26923
  • Tissue specificity: Expression is prominent in heart, placenta, liver, kidney and pancreas. {ECO
• Sequence:

  MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHT
  DTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPE
  EVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPD
  DEEIELAYEQVAKALK

• Structural information:
  • Protein Domains: (93..23-)
    (/note="GST-C-terminal")
  • Interpro: IPR002946  IPR030259  IPR010987  IPR036282  IPR040079   IPR004045  IPR036249  
  • Prosite: PS50405
  • PDB: 1K0M 1K0N 1K0O 1RK4 3O3T 3P8W 3P90 3QR6 3SWL 3TGZ 3UVH 4IQA 4JZQ 4K0G 4K0N
  • PDBsum: 1K0M 1K0N 1K0O 1RK4 3O3T 3P8W 3P90 3QR6 3SWL 3TGZ 3UVH 4IQA 4JZQ 4K0G 4K0N
  • STRING: ENSP00000364935
• Other Databases: GeneCards:  CLIC1  Malacards:  CLIC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005254	chloride channel activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006821	chloride transport	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0005254	chloride channel activity	IEA	molecular function
GO:0034707	chloride channel complex	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0006821	chloride transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005254	chloride channel activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006821	chloride transport	IDA	biological process
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005254	chloride channel activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045669	positive regulation of osteoblast differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0051881	regulation of mitochondrial membrane potential	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0031982	vesicle	HDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070527	platelet aggregation	HMP	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005903	brush border	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0005737	cytoplasm	HDA	cellular component
GO:0005254	chloride channel activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006821	chloride transport	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0005254	chloride channel activity	IEA	molecular function
GO:0034707	chloride channel complex	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0006821	chloride transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005254	chloride channel activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006821	chloride transport	IDA	biological process
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005254	chloride channel activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045669	positive regulation of osteoblast differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0051881	regulation of mitochondrial membrane potential	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0031982	vesicle	HDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070527	platelet aggregation	HMP	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005903	brush border	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0005737	cytoplasm	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881