• Gene id: 119180

Gene Summary

• Gene Symbol: LYZL2   Gene   UCSC   Ensembl
• Aliases: LYZD2
• Gene name: lysozyme like 2
• Alternate names: lysozyme-like protein 2, lysozyme D2, lysozyme-2,
• Gene location: 10p11.23 (30629760: 30606221)     Exons: 35     NC_000010.11
• Gene summary(Entrez): Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. LYZL2 is a member of a family of lysozyme-like genes (Zhang
• OMIM: 612748

Protein Summary

• Protein general information: Q7Z4W2  
  • Name: Lysozyme like protein 2 (Lysozyme 2) (EC 3.2.1.17)
  • Length: 148  
  • Mass: 16656
  • Tissue specificity: Expressed in testis, epididymis and placenta. {ECO
• Sequence:

  MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIF
  QINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS

• Structural information:
  • Protein Domains: (20..14-)
    (/note="C-type-lysozyme)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00680"-)
  • Interpro: IPR001916  IPR019799  IPR000974  IPR023346  IPR030057  
  • Prosite: PS00128 PS51348
  • STRING: ENSP00000364467
• Other Databases: GeneCards:  LYZL2  Malacards:  LYZL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050830	defense response to Gram-positive bacterium	IBA	biological process
GO:0050829	defense response to Gram-negative bacterium	IBA	biological process
GO:0003796	lysozyme activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0003796	lysozyme activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R