• Gene id: 1191

Gene Summary

• Gene Symbol: CLU   Gene   UCSC   Ensembl
• Aliases: AAG4, APO-J, APOJ, CLI, CLU1, CLU2, KUB1, NA1/NA2, SGP-2, SGP2, SP-40, TRPM-2, TRPM2
• Gene name: clusterin
• Alternate names: clusterin, aging-associated protein 4, apolipoprotein J, complement cytolysis inhibitor, complement lysis inhibitor, complement-associated protein SP-40,40, ku70-binding protein 1, sulfated glycoprotein 2, testosterone-repressed prostate message 2,
• Gene location: 8p21.1 (27615030: 27596916)     Exons: 11     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegen
• OMIM: 185430

Protein Summary

• Protein general information: P10909  
  • Name: Clusterin (Aging associated gene 4 protein) (Apolipoprotein J) (Apo J) (Complement cytolysis inhibitor) (CLI) (Complement associated protein SP 40,40) (Ku70 binding protein 1) (NA1/NA2) (Testosterone repressed prostate message 2) (TRPM 2) [Cleaved into: C
  • Length: 449  
  • Mass: 52,495
• Sequence:

  MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLE
  EAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPF
  YFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRI
  VRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKD
  QCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANL
  TQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

• Structural information:
  • Interpro: IPR016016  IPR000753  IPR016015  IPR033986  IPR016014  
  • Prosite: PS00492 PS00493
  • DIP: 37546
  • STRING: ENSP00000315130
• Other Databases: GeneCards:  CLU  Malacards:  CLU

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000902	cell morphogenesis	IDA	biological process
GO:0001774	microglial cell activation	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IC	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005622	intracellular	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0006629	lipid metabolic process	NAS	biological process
GO:0006956	complement activation	TAS	biological process
GO:0006958	complement activation, classical pathway	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0009416	response to light stimulus	IEA	biological process
GO:0009611	response to wounding	IEA	biological process
GO:0009615	response to virus	IEP	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0016235	aggresome	IEA	cellular component
GO:0017038	protein import	IDA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031018	endocrine pancreas development	IEA	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0031625	ubiquitin protein ligase binding	IDA	molecular function
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0032286	central nervous system myelin maintenance	IMP	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0032463	negative regulation of protein homooligomerization	IMP	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IDA	biological process
GO:0034366	spherical high-density lipoprotein particle	IDA	cellular component
GO:0035864	response to potassium ion	IEA	biological process
GO:0042583	chromaffin granule	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043691	reverse cholesterol transport	TAS	biological process
GO:0044849	estrous cycle	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IDA	biological process
GO:0045597	positive regulation of cell differentiation	IEA	biological process
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0051087	chaperone binding	ISS	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0051131	chaperone-mediated protein complex assembly	IDA	biological process
GO:0051787	misfolded protein binding	IDA	molecular function
GO:0051787	misfolded protein binding	IPI	molecular function
GO:0051788	response to misfolded protein	IDA	biological process
GO:0061077	chaperone-mediated protein folding	IDA	biological process
GO:0061518	microglial cell proliferation	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0072562	blood microparticle	IDA	cellular component
GO:0097193	intrinsic apoptotic signaling pathway	IDA	biological process
GO:0097418	neurofibrillary tangle	IDA	cellular component
GO:0097418	neurofibrillary tangle	IDA	cellular component
GO:0097440	apical dendrite	IDA	cellular component
GO:1900221	regulation of beta-amyloid clearance	IDA	biological process
GO:1901214	regulation of neuron death	IDA	biological process
GO:1901214	regulation of neuron death	IMP	biological process
GO:1901216	positive regulation of neuron death	IDA	biological process
GO:1901216	positive regulation of neuron death	IMP	biological process
GO:1902004	positive regulation of beta-amyloid formation	ISS	biological process
GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	biological process
GO:1902430	negative regulation of beta-amyloid formation	IDA	biological process
GO:1902430	negative regulation of beta-amyloid formation	IDA	biological process
GO:1902847	regulation of neuronal signal transduction	IMP	biological process
GO:1902949	positive regulation of tau-protein kinase activity	IMP	biological process
GO:1902998	positive regulation of neurofibrillary tangle assembly	IMP	biological process
GO:2000060	positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process	IMP	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:0016887	ATPase activity	IDA	molecular function
GO:0031012	extracellular matrix	IDA	cellular component
GO:0000902	cell morphogenesis	IDA	biological process
GO:0001774	microglial cell activation	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IC	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005622	intracellular	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0006629	lipid metabolic process	NAS	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006956	complement activation	TAS	biological process
GO:0006958	complement activation, classical pathway	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0008219	cell death	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0009416	response to light stimulus	IEA	biological process
GO:0009611	response to wounding	IEA	biological process
GO:0009615	response to virus	IEP	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016235	aggresome	IEA	cellular component
GO:0017038	protein import	IDA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031018	endocrine pancreas development	IEA	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0031625	ubiquitin protein ligase binding	IDA	molecular function
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0032286	central nervous system myelin maintenance	IMP	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0032463	negative regulation of protein homooligomerization	IMP	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IDA	biological process
GO:0034366	spherical high-density lipoprotein particle	IDA	cellular component
GO:0035864	response to potassium ion	IEA	biological process
GO:0042583	chromaffin granule	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043234	protein complex	IDA	cellular component
GO:0043691	reverse cholesterol transport	TAS	biological process
GO:0044849	estrous cycle	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IDA	biological process
GO:0045597	positive regulation of cell differentiation	IEA	biological process
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0051087	chaperone binding	ISS	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0051131	chaperone-mediated protein complex assembly	IDA	biological process
GO:0051787	misfolded protein binding	IDA	molecular function
GO:0051787	misfolded protein binding	IPI	molecular function
GO:0051788	response to misfolded protein	IDA	biological process
GO:0061077	chaperone-mediated protein folding	IDA	biological process
GO:0061518	microglial cell proliferation	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0072562	blood microparticle	IDA	cellular component
GO:0097193	intrinsic apoptotic signaling pathway	IDA	biological process
GO:0097418	neurofibrillary tangle	IDA	cellular component
GO:0097418	neurofibrillary tangle	IDA	cellular component
GO:0097440	apical dendrite	IDA	cellular component
GO:1900221	regulation of beta-amyloid clearance	IDA	biological process
GO:1901214	regulation of neuron death	IDA	biological process
GO:1901214	regulation of neuron death	IMP	biological process
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:1901216	positive regulation of neuron death	IDA	biological process
GO:1901216	positive regulation of neuron death	IMP	biological process
GO:1902004	positive regulation of beta-amyloid formation	IEA	biological process
GO:1902004	positive regulation of beta-amyloid formation	ISS	biological process
GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	biological process
GO:1902430	negative regulation of beta-amyloid formation	IDA	biological process
GO:1902430	negative regulation of beta-amyloid formation	IDA	biological process
GO:1902847	regulation of neuronal signal transduction	IMP	biological process
GO:1902949	positive regulation of tau-protein kinase activity	IMP	biological process
GO:1902998	positive regulation of neurofibrillary tangle assembly	IMP	biological process
GO:2000060	positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process	IMP	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:0016887	ATPase activity	IDA	molecular function
GO:0031012	extracellular matrix	IDA	cellular component
GO:0000902	cell morphogenesis	IDA	biological process
GO:0001774	microglial cell activation	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IC	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0006629	lipid metabolic process	NAS	biological process
GO:0006956	complement activation	TAS	biological process
GO:0009615	response to virus	IEP	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0017038	protein import	IDA	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0031625	ubiquitin protein ligase binding	IDA	molecular function
GO:0032286	central nervous system myelin maintenance	IMP	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0032463	negative regulation of protein homooligomerization	IMP	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IDA	biological process
GO:0034366	spherical high-density lipoprotein particle	IDA	cellular component
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043691	reverse cholesterol transport	TAS	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050821	protein stabilization	IDA	biological process
GO:0051087	chaperone binding	ISS	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0051131	chaperone-mediated protein complex assembly	IDA	biological process
GO:0051787	misfolded protein binding	IDA	molecular function
GO:0051787	misfolded protein binding	IPI	molecular function
GO:0051788	response to misfolded protein	IDA	biological process
GO:0061077	chaperone-mediated protein folding	IDA	biological process
GO:0061518	microglial cell proliferation	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072562	blood microparticle	IDA	cellular component
GO:0097193	intrinsic apoptotic signaling pathway	IDA	biological process
GO:0097418	neurofibrillary tangle	IDA	cellular component
GO:0097418	neurofibrillary tangle	IDA	cellular component
GO:0097440	apical dendrite	IDA	cellular component
GO:1900221	regulation of beta-amyloid clearance	IDA	biological process
GO:1901214	regulation of neuron death	IDA	biological process
GO:1901214	regulation of neuron death	IMP	biological process
GO:1901216	positive regulation of neuron death	IDA	biological process
GO:1901216	positive regulation of neuron death	IMP	biological process
GO:1902004	positive regulation of beta-amyloid formation	ISS	biological process
GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	biological process
GO:1902430	negative regulation of beta-amyloid formation	IDA	biological process
GO:1902430	negative regulation of beta-amyloid formation	IDA	biological process
GO:1902847	regulation of neuronal signal transduction	IMP	biological process
GO:1902949	positive regulation of tau-protein kinase activity	IMP	biological process
GO:1902998	positive regulation of neurofibrillary tangle assembly	IMP	biological process
GO:2000060	positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process	IMP	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:0016887	ATPase activity	IDA	molecular function
GO:0031012	extracellular matrix	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Cancer (lymphoma)	GAD: 19344414
Cancer	GAD: 19344414
Cardiovascular disease	GAD: 20410100
Carotid artery diseases	GAD: 15883054
Macular degeneration	GAD: 18842294
Exfoliation syndrome	GAD: 18806885
Alzheimer's disease	GAD: 19734902
Panic disorder	GAD: 19165232
Schizophrenia	GAD: 20738160
Preeclampsia	GAD: 15925890
Preeclampsia	GAD: 15925890
Sperm DNA fragmentation	MIK: 23740886
Semen quality	MIK: 23740886
Male factor infertility	MIK: 22902018
Protamine deficiency	MIK: 23740886
Spermatogenesis defects	MIK: 16709604
Azoospermia	MIK: 16709604
Abnormal morphology	MIK: 23740886
Asthenozoospermia	MIK: 25825237
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 25825237
Cryptorchidism	MIK: 28606200
Important for sperm maturation and capacitation	MIK: 28971894
Male infertility	MIK: 22902018
Oligozoospermia	MIK: 26939938
Nonobstructive azoospermia (NOA)	MIK: 26939938
Protamine deficiency	MIK: 23740886
Sperm DNA fragmentation	MIK: 23740886
Semen quality	MIK: 23740886
Abnormal morphology	MIK: 23740886
Spermatogenic defects	MIK: 31037746
Azoospermia	MIK: 16709604
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25825237	Asthenozoospermia				Male infertility	Tubulin beta 2B; glutathione S-transferase Mu 3; keratin type II cytoskeletal 1; outer dense fiber protein 2; voltage-dependent anion-selective channel protein 2; A-kinase anchor protein 4; cytochrome c oxidase subunit 6B; sperm protein associated with t
23740886	Protamine deficiency, sperm DNA fragmentation, semen quality, abnormal morphology		Iranian	63 Iranian men	Male infertility
22902018	Male infertility			124 men were divided into healthy, fertile men with normozoospermia, and men with asthenozoospermia, asthenoteratozoospermia and oligoasthenoteratozoospermia	Male infertility
21536282	Male infertility				Male infertility	Semenogelin II precursor  clusterin isoform 1
16709604	Spermatogenic failure, azoospermia			49 azoospermic patients	Male infertility	SCF clusterin
28971894	Important for sperm maturation and capacitation, Male infertility				Male infertility
26939938	Normospermia, oligozoospermia and nonobstructive azoospermia (NOA), Male infertility			89 (28 diagnosed with normospermia, 33 with oligozoospermia, 28 with nonobstructive azoospermia (NOA))	Male infertility
30276845	Unexplained male infertility			5 Unexplained male infertility men with successful and eight with unsuccessful IVF outcome enrolled	Male infertility	epididymal secretory protein E1 prostate-specific antigen
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R