• Gene id: 118856

Gene Summary

• Gene Symbol: MMP21   Gene   UCSC   Ensembl
• Aliases: HTX7, MMP-21
• Gene name: matrix metallopeptidase 21
• Alternate names: matrix metalloproteinase-21, matrix metalloproteinase 21,
• Gene location: 10q26.2 (125775820: 125766452)     Exons: 7     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the matrix metalloproteinase family. Proteins in this family are involved in the breakdown of extracellular matrix for both normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, a

Protein Summary

• Protein general information: Q8N119  
  • Name: Matrix metalloproteinase 21 (MMP 21) (EC 3.4.24. )
  • Length: 569  
  • Mass: 65043
  • Tissue specificity: Identified in fetal brain, kidney and liver. In adult tissues found primarily in ovary, kidney, liver, lung, placenta, brain and peripheral blood leukocytes. Expressed as well in various cancer cell lines. {ECO
• Sequence:

  MLAASIFRPTLLLCWLAAPWPTQPESLFHSRDRSDLEPSPLRQAKPIADLHAAQRFLSRYGWSGVWAAWGPSPEG
  PPETPKGAALAEAVRRFQRANALPASGELDAATLAAMNRPRCGVPDMRPPPPSAPPSPPGPPPRARSRRSPRAPL
  SLSRRGWQPRGYPDGGAAQAFSKRTLSWRLLGEALSSQLSVADQRRIVALAFRMWSEVTPLDFREDLAAPGAAVD
  IKLGFGRGRHLGCPRAFDGSGQEFAHAWRLGDIHFDDDEHFTPPTSDTGISLLKVAVHEIGHVLGLPHTYRTGSI
  MQPNYIPQEPAFELDWSDRKAIQKLYGSCEGSFDTAFDWIRKERNQYGEVMVRFSTYFFRNSWYWLYENRNNRTR
  YGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYDSDKDQALTEDEQGKSYPKLISEGFPGIPSP
  LDTAFYDRRQKLIYFFKESLVFAFDVNRNRVLNSYPKRITEVFPAVIPQNHPFRNIDSAYYSYAYNSIFFFKGNA
  YWKVVNDKDKQQNSWLPANGLFPKKFISEKWFDVCDVHISTLNM

• Structural information:
  • Interpro: IPR000585  IPR036375  IPR018487  IPR033739  IPR024079   IPR001818  IPR021190  IPR006026  IPR002477  IPR036365  
  • Prosite: PS51642 PS00142
  • CDD: cd00094 cd04278
  • STRING: ENSP00000357798
• Other Databases: GeneCards:  MMP21  Malacards:  MMP21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004222	metalloendopeptidase activity	IBA	molecular function
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0030574	collagen catabolic process	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0061371	determination of heart left/right asymmetry	ISS	biological process
GO:0007368	determination of left/right symmetry	IMP	biological process
GO:0007368	determination of left/right symmetry	IMP	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0061371	determination of heart left/right asymmetry	IEA	biological process
GO:0060976	coronary vasculature development	IEA	biological process
GO:0007368	determination of left/right symmetry	IEA	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Heterotaxy	KEGG:H00632
Heterotaxy	KEGG:H00632
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq