• Gene id: 118471

Gene Summary

• Gene Symbol: PRAP1   Gene   UCSC   Ensembl
• Aliases: PRO1195, UPA
• Gene name: proline rich acidic protein 1
• Alternate names: proline-rich acidic protein 1, epididymis secretory sperm binding protein, epididymis tissue protein Li 178,
• Gene location: 10q26.3 (133347372: 133352682)     Exons: 5     NC_000010.11
• OMIM: 610457

Protein Summary

• Protein general information: Q96NZ9  
  • Name: Proline rich acidic protein 1 (Epididymis tissue protein Li 178) (Uterine specific proline rich acidic protein)
  • Length: 151  
  • Mass: 17208
  • Tissue specificity: Abundantly expressed in the epithelial cells of the liver, kidney, gastrointestinal tract and cervix. Significantly down-regulated in hepatocellular carcinoma and right colon adenocarcinoma compared with the respective adjacent normal
• Sequence:

  MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEE
  KPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHP
  Q

• Structural information:
  • Interpro: IPR027922  
  • STRING: ENSP00000416126
• Other Databases: GeneCards:  PRAP1  Malacards:  PRAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray