• Gene id: 118460

Gene Summary

• Gene Symbol: EXOSC6   Gene   UCSC   Ensembl
• Aliases: EAP4, MTR3, Mtr3p, hMtr3p, p11
• Gene name: exosome component 6
• Alternate names: exosome complex component MTR3, Mtr3 (mRNA transport regulator 3)-homolog, exosome complex exonuclease MTR3, hMtr3, homolog of yeast mRNA transport regulator 3, mRNA transport regulator 3 homolog,
• Gene location: 16q22.1 (70251939: 70246777)     Exons: 1     NC_000016.10
• Gene summary(Entrez): This gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its

Protein Summary

• Protein general information: Q5RKV6  
  • Name: Exosome complex component MTR3 (Exosome component 6) (mRNA transport regulator 3 homolog) (hMtr3) (p11)
  • Length: 272  
  • Mass: 28235
• Sequence:

  MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGG
  ERGGGPAGAGGEAPAALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALL
  LEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVALMPVLNQVAGL
  LGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAAQP

• Structural information:
  • Interpro: IPR001247  IPR036345  IPR027408  IPR020568  
  • PDB: 2NN6 6D6Q 6D6R 6H25
  • PDBsum: 2NN6 6D6Q 6D6R 6H25
  • DIP: 61038
  • STRING: ENSP00000398597
• Other Databases: GeneCards:  EXOSC6  Malacards:  EXOSC6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000176	nuclear exosome (RNase complex)	IBA	cellular component
GO:0000177	cytoplasmic exosome (RNase complex)	IBA	cellular component
GO:0005730	nucleolus	IBA	cellular component
GO:0034475	U4 snRNA 3'-end processing	IBA	biological process
GO:0016075	rRNA catabolic process	IBA	biological process
GO:0034427	nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5'	IBA	biological process
GO:0071028	nuclear mRNA surveillance	IBA	biological process
GO:0071051	polyadenylation-dependent snoRNA 3'-end processing	IBA	biological process
GO:0004532	exoribonuclease activity	IDA	NOT|molecular function
GO:0045006	DNA deamination	IDA	biological process
GO:0045190	isotype switching	ISS	biological process
GO:0000178	exosome (RNase complex)	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006364	rRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006364	rRNA processing	TAS	biological process
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0045830	positive regulation of isotype switching	IEA	biological process
GO:0045190	isotype switching	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0000178	exosome (RNase complex)	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881