About Us

Search Result


Gene id 118430
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol MUCL1   Gene   UCSC   Ensembl
Aliases SBEM
Gene name mucin like 1
Alternate names mucin-like protein 1, small breast epithelial mucin,
Gene location 12q13.2 (54854515: 54858386)     Exons: 4     NC_000012.12
OMIM 607194

Protein Summary

Protein general information Q96DR8  

Name: Mucin like protein 1 (Protein BS106) (Small breast epithelial mucin)

Length: 90  Mass: 9039

Tissue specificity: Expressed in mammary, salivary glands and prostate. Also detected in lung. Mainly expressed in cancer cell lines of breast origin. Highly expressed in lymph node-positive compared with node-negative tumors. Detected in all lymph node c

Sequence MKFLAVLVLLGVSIFLVSAQNPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTARKDIPV
LPKWVGDLPNGRVCP
Structural information
MINT:  
STRING:   ENSP00000311364
Other Databases GeneCards:  MUCL1  Malacards:  MUCL1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005576 extracellular region
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0016266 O-glycan processing
TAS biological process
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
TAS biological process
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0016020 membrane
IEA cellular component
Associated diseases References
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract