• Gene id: 118424

Gene Summary

• Gene Symbol: UBE2J2   Gene   UCSC   Ensembl
• Aliases: NCUBE-2, NCUBE2, PRO2121
• Gene name: ubiquitin conjugating enzyme E2 J2
• Alternate names: ubiquitin-conjugating enzyme E2 J2, E2 ubiquitin-conjugating enzyme J2, non-canonical ubiquitin-conjugating enzyme 2, ubiquitin conjugating enzyme 6, ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast), yeast UBC6 homolog,
• Gene location: 1p36.33 (1273853: 1253911)     Exons: 11     NC_000001.11
• Gene summary(Entrez): The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conju
• OMIM: 0

Protein Summary

• Protein general information: Q8N2K1  
  • Name: Ubiquitin conjugating enzyme E2 J2 (EC 2.3.2.23) (E2 ubiquitin conjugating enzyme J2) (Non canonical ubiquitin conjugating enzyme 2) (NCUBE 2)
  • Length: 259  
  • Mass: 28898
• Sequence:

  MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKP
  PSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDFTKRQLAVQSLAFN
  LKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANRH
  HGLLGGALANLFVIVGFAAFAYTVKYVLRSIAQE

• Structural information:
  • Interpro: IPR000608  IPR016135  
  • Prosite: PS50127
  • CDD: cd00195
  • PDB: 2F4W
  • PDBsum: 2F4W
  • STRING: ENSP00000383719
• Other Databases: GeneCards:  UBE2J2  Malacards:  UBE2J2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016740	transferase activity	IEA	molecular function
GO:0006986	response to unfolded protein	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IDA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0000151	ubiquitin ligase complex	IPI	cellular component
GO:1903955	positive regulation of protein targeting to mitochondrion	HMP	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05012	Parkinson disease
hsa04141	Protein processing in endoplasmic reticulum
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R