• Gene id: 117854

Gene Summary

• Gene Symbol: TRIM6   Gene   UCSC   Ensembl
• Aliases: RNF89
• Gene name: tripartite motif containing 6
• Alternate names: tripartite motif-containing protein 6, RING finger protein 89, RING-type E3 ubiquitin transferase TRIM6,
• Gene location: 11p15.4 (5596110: 5612951)     Exons: 9     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, B-box type 1 and B-box type 2 domain, and a coiled-coil region. The protein localizes to the nucleus, but its s
• OMIM: 607915

Protein Summary

• Protein general information: Q9C030  
  • Name: Tripartite motif containing protein 6 (EC 2.3.2.27) (RING finger protein 89) (RING type E3 ubiquitin transferase TRIM6)
  • Length: 488  
  • Mass: 56400
• Sequence:

  MTSPVLVDIREEVTCPICLELLTEPLSIDCGHSFCQACITPNGRESVIGQEGERSCPVCQTSYQPGNLRPNRHLA
  NIVRRLREVVLGPGKQLKAVLCADHGEKLQLFCQEDGKVICWLCERSQEHRGHHTFLVEEVAQEYQEKFQESLKK
  LKNEEQEAEKLTAFIREKKTSWKNQMEPERCRIQTEFNQLRNILDRVEQRELKKLEQEEKKGLRIIEEAENDLVH
  QTQSLRELISDLERRCQGSTMELLQDVSDVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVCRELTDVQSYW
  VDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFSSGKHYWEVDVAKKTAWILGVCSNS
  LGPTFSFNHFAQNHSAYSRYQPQSGYWVIGLQHNHEYRAYEDSSPSLLLSMTVPPRRVGVFLDYEAGTVSFYNVT
  NHGFPIYTFSKYYFPTTLCPYFNPCNCVIPMTLRRPSS

• Structural information:
  • Protein Domains: (282..48-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR006574  IPR035828   IPR003877  IPR027370  IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS50119 PS00518 PS50089
  • CDD: cd00021 cd15823
  • STRING: ENSP00000369440
• Other Databases: GeneCards:  TRIM6  Malacards:  TRIM6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0010508	positive regulation of autophagy	IBA	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0032880	regulation of protein localization	IBA	biological process
GO:0046596	regulation of viral entry into host cell	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008134	transcription factor binding	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0098586	cellular response to virus	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0045071	negative regulation of viral genome replication	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0060340	positive regulation of type I interferon-mediated signaling pathway	IEA	biological process
GO:2000737	negative regulation of stem cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0010994	free ubiquitin chain polymerization	IMP	biological process
GO:1901222	regulation of NIK/NF-kappaB signaling	IMP	NOT|biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0060340	positive regulation of type I interferon-mediated signaling pathway	IMP	biological process
GO:0002741	positive regulation of cytokine production involved in immune response	IMP	biological process
GO:1990782	protein tyrosine kinase binding	IPI	molecular function
GO:0002230	positive regulation of defense response to virus by host	IMP	biological process
GO:0032496	response to lipopolysaccharide	IMP	biological process
GO:0035458	cellular response to interferon-beta	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0045071	negative regulation of viral genome replication	IMP	biological process
GO:0061630	ubiquitin protein ligase activity	IMP	molecular function
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IMP	biological process
GO:0030674	protein-macromolecule adaptor activity	IPI	molecular function
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:2000679	positive regulation of transcription regulatory region DNA binding	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray