• Gene id: 117283

Gene Summary

• Gene Symbol: IP6K3   Gene   UCSC   Ensembl
• Aliases: IHPK3, INSP6K3
• Gene name: inositol hexakisphosphate kinase 3
• Alternate names: inositol hexakisphosphate kinase 3, ATP:1D-myo-inositol-hexakisphosphate phosphotransferase, InsP6 kinase 3, inositol hexaphosphate kinase 3,
• Gene location: 6p21.31 (241847966: 241889938)     Exons: 18     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,
• OMIM: 606993

Protein Summary

• Protein general information: Q96PC2  
  • Name: Inositol hexakisphosphate kinase 3 (InsP6 kinase 3) (EC 2.7.4.21) (Inositol hexaphosphate kinase 3)
  • Length: 410  
  • Mass: 46417
  • Tissue specificity: Detected in brain.
• Sequence:

  MVVQNSADAGDMRAGVQLEPFLHQVGGHMSVMKYDEHTVCKPLVSREQRFYESLPLAMKRFTPQYKGTVTVHLWK
  DSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSDCTLAQWPHAQLARSPKESPAKALLRSEPHL
  NTPAFSLVEDTNGNQVERKSFNPWGLQCHQAHLTRLCSEYPENKRHRFLLLENVVSQYTHPCVLDLKMGTRQHGD
  DASEEKKARHMRKCAQSTSACLGVRICGMQVYQTDKKYFLCKDKYYGRKLSVEGFRQALYQFLHNGSHLRRELLE
  PILHQLRALLSVIRSQSSYRFYSSSLLVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMIDFAHTTY
  KGYWNEHTTYDGPDPGYIFGLENLIRILQDIQEGE

• Structural information:
  • Interpro: IPR005522  IPR038286  
  • STRING: ENSP00000398861
• Other Databases: GeneCards:  IP6K3  Malacards:  IP6K3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000828	inositol hexakisphosphate kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0032958	inositol phosphate biosynthetic process	IBA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0016301	kinase activity	IBA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0032958	inositol phosphate biosynthetic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0052723	inositol hexakisphosphate 1-kinase activity	IEA	molecular function
GO:0000827	inositol-1,3,4,5,6-pentakisphosphate kinase activity	IEA	molecular function
GO:0000832	inositol hexakisphosphate 5-kinase activity	IEA	molecular function
GO:0052724	inositol hexakisphosphate 3-kinase activity	IEA	molecular function
GO:0032958	inositol phosphate biosynthetic process	IDA	biological process
GO:0000831	inositol hexakisphosphate 6-kinase activity	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0000828	inositol hexakisphosphate kinase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0046488	phosphatidylinositol metabolic process	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04070	Phosphatidylinositol signaling system

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq