• Gene id: 117247

Gene Summary

• Gene Symbol: SLC16A10   Gene   UCSC   Ensembl
• Aliases: MCT10, PRO0813, TAT1
• Gene name: solute carrier family 16 member 10
• Alternate names: monocarboxylate transporter 10, MCT 10, T-type amino acid transporter 1, aromatic amino acid transporter 1, solute carrier family 16 (aromatic amino acid transporter), member 10, solute carrier family 16 (monocarboxylic acid transporters), member 10, solute car,
• Gene location: 6q21 (111087502: 111231193)     Exons: 10     NC_000006.12
• Gene summary(Entrez): SLC16A10 is a member of a family of plasma membrane amino acid transporters that mediate the Na(+)-independent transport of aromatic amino acids across the plasma membrane.[supplied by OMIM, Apr 2004]
• OMIM: 607550

Protein Summary

• Protein general information: Q8TF71  
  • Name: Monocarboxylate transporter 10 (MCT 10) (Aromatic amino acid transporter 1) (Solute carrier family 16 member 10) (T type amino acid transporter 1)
  • Length: 515  
  • Mass: 55493
  • Tissue specificity: Strongly expressed in kidney and skeletal muscle and at lower level in placenta and heart. {ECO
• Sequence:

  MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHEPPEPPEGGWGWLVML
  AAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSLSMGMIFFCCPIVSVFTDLFGCRKTAVVGAA
  VGFVGLMSSSFVSSIEPLYLTYGIIFACGCSFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLI
  DSVGLFYTLRVLCIFMFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPKKIFNFAIFKVTAYAVWAVGI
  PLALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIADYVPGVKKVYLQVLSFFFIGLMSMM
  IPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAIGFLLGFMSIPMTVGPPIAGLLRDKLGSYDV
  AFYLAGVPPLIGGAVLCFIPWIHSKKQREISKTTGKEKMEKMLENQNSLLSSSSGMFKKESDSII

• Structural information:
  • Interpro: IPR030762  IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000357844
• Other Databases: GeneCards:  SLC16A10  Malacards:  SLC16A10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016323	basolateral plasma membrane	TAS	cellular component
GO:0015801	aromatic amino acid transport	TAS	biological process
GO:0008028	monocarboxylic acid transmembrane transporter activity	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0015173	aromatic amino acid transmembrane transporter activity	IEA	molecular function
GO:0015349	thyroid hormone transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015171	amino acid transmembrane transporter activity	TAS	molecular function
GO:0006865	amino acid transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070327	thyroid hormone transport	IEA	biological process
GO:0070460	thyroid-stimulating hormone secretion	IEA	biological process
GO:0006590	thyroid hormone generation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0015718	monocarboxylic acid transport	IEA	biological process
GO:0003333	amino acid transmembrane transport	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04919	Thyroid hormone signaling pathway
hsa04974	Protein digestion and absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray